StarFunc result for job id Q4G176

User Input

>input (576 residues)
MLPHVVLTFRRLGCALASCRLAPARHRGSGLLHTAPVARSDRSAPVFTRALAFGDRIALV
DQHGRHTYRELYSRSLRLSQEICRLCGCVGGDLREERVSFLCANDASYVVAQWASWMSGG
VAVPLYRKHPAAQLEYVICDSQSSVVLASQEYLELLSPVVRKLGVPLLPLTPAIYTGAVE
EPAEVPVPEQGWRNKGAMIIYTSGTTGRPKGVLSTHQNIRAVVTGLVHKWAWTKDDVILH
VLPLHHVHGVVNALLCPLWVGATCVMMPEFSPQQVWEKFLSSETPRINVFMAVPTIYTKL
MEYYDRHFTQPHAQDFLRAVCEEKIRLMVSGSAALPLPVLEKWKNITGHTLLERYGMTEI
GMALSGPLTTAVRLPGSVGTPLPGVQVRIVSENPQREACSYTIHAEGDERGTKVTPGFEE
KEGELLVRGPSVFREYWNKPEETKSAFTLDGWFKTGDTVVFKDGQYWIRGRTSVDIIKTG
GYKVSALEVEWHLLAHPSITDVAVIGVPDMTWGQRVTAVVTLREGHSLSHRELKEWARNV
LAPYAVPSELVLVEEIPRNQMGKIDKKALIRHFHPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4G176	1.000	1.000	0.000	576	1.000	1.000	Q4G176.pdb.gz	ACSF3_HUMAN Malonate--CoA ligase ACSF3, mitochondrial OS=Homo sapiens OX=9606 GN=ACSF3 PE=1 SV=3
2	AFDB:Q3URE1	0.926	0.916	4.349E-104	583	0.788	0.779	Q3URE1.pdb.gz	ACSF3_MOUSE Malonate--CoA ligase ACSF3, mitochondrial OS=Mus musculus OX=10090 GN=Acsf3 PE=1 SV=2
3	AFDB:Q8H151	0.813	0.772	1.550E-62	608	0.389	0.368	Q8H151.pdb.gz	AAE13_ARATH Malonate--CoA ligase OS=Arabidopsis thaliana OX=3702 GN=AAE13 PE=1 SV=2
4	AFDB:M4IS90	0.835	0.794	2.179E-61	607	0.387	0.367	M4IS90.pdb.gz	CCL8_HUMLU Probable CoA ligase CCL8 OS=Humulus lupulus OX=3486 GN=CCL8 PE=2 SV=1
5	AFDB:Q384Q3	0.767	0.614	4.402E-50	727	0.344	0.272	Q384Q3.pdb.gz	Q384Q3_TRYB2 Long-chain-fatty-acid-coA ligase protein,putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5520 PE=4 SV=1
6	AFDB:Q9SMT7	0.762	0.849	1.022E-44	514	0.259	0.290	Q9SMT7.pdb.gz	4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana OX=3702 GN=AAE3 PE=1 SV=1
7	PDB:5ie2A	0.777	0.880	1.109E-44	506	0.264	0.300	5ie2A.pdb.gz	Crystal Structures of Arabidopsis thaliana Oxalyl-CoA Synthetase Essential for Oxalate Degradation
8	AFDB:O74976	0.753	0.843	1.286E-44	512	0.253	0.285	O74976.pdb.gz	FAT2_SCHPO Oxalate--CoA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pcs60 PE=1 SV=1
9	AFDB:Q54WL7	0.780	0.826	2.419E-44	542	0.240	0.255	Q54WL7.pdb.gz	Q54WL7_DICDI AMP-dependent synthetase and ligase domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279561 PE=3 SV=1
10	AFDB:P38137	0.768	0.812	4.822E-44	543	0.247	0.262	P38137.pdb.gz	FAT2_YEAST Oxalate--CoA ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PCS60 PE=1 SV=1
11	AFDB:Q9EY88	0.620	0.722	1.204E-42	491	0.257	0.301	Q9EY88.pdb.gz	FCS_AMYSP Feruloyl-CoA synthase OS=Amycolatopsis sp. OX=37632 GN=fcs PE=1 SV=1
12	PDB:3r44A	0.623	0.707	8.153E-40	502	0.243	0.279	3r44A.pdb.gz	The Mycobacterium tuberculosis Very-Long-Chain Fatty Acyl-CoA Synthetase: Structural Basis for Housing Lipid Substrates Longer than the Enzyme.
13	PDB:1ultA	0.649	0.696	3.632E-39	533	0.252	0.272	1ultA.pdb.gz
14	PDB:6q2mA	0.755	0.797	5.707E-37	544	0.229	0.243	6q2mA.pdb.gz	Mutagenesis and Structural Studies Reveal the Basis for the Activity and Stability Properties That Distinguish thePhotinusLuciferasesscintillansandpyralis.
15	PDB:5bsmA	0.740	0.799	1.351E-36	530	0.220	0.240	5bsmA.pdb.gz	Structural Basis for Specificity and Flexibility in a Plant 4-Coumarate:CoA Ligase.
16	PDB:7kydA	0.731	0.783	8.498E-36	534	0.224	0.242	7kydA.pdb.gz	FruitFire: a luciferase based on a fruit fly metabolic enzyme.
17	PDB:3rg2C	0.614	0.579	1.425E-35	613	0.207	0.194	3rg2C.pdb.gz	Structural and Functional Investigation of the Intermolecular Interaction between NRPS Adenylation and Carrier Protein Domains.
18	PDB:2p20A	0.601	0.543	1.504E-34	641	0.229	0.206	2p20A.pdb.gz	Biochemical and Crystallographic Analysis of Substrate Binding and Conformational Changes in Acetyl-CoA Synthetase.
19	PDB:5ja2A	0.581	0.284	1.687E-34	1238	0.210	0.098	5ja2A.pdb.gz	Structures of a Nonribosomal Peptide Synthetase Module Bound to MbtH-like Proteins Support a Highly Dynamic Domain Architecture.
20	PDB:3b7wA	0.615	0.657	6.325E-34	537	0.210	0.225	3b7wA.pdb.gz	Structural snapshots for the conformation-dependent catalysis by human medium-chain acyl-coenzyme A synthetase ACSM2A.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F5H5A1	0.0	642	311	0.540	1.000	F5H5A1_HUMAN Acyl-CoA synthetase family member 3 OS=Homo sapiens OX=9606 GN=ACSF3 PE=1 SV=1
2	Q3URE1	0.0	946	583	0.792	0.782	ACSF3_MOUSE Malonate--CoA ligase ACSF3, mitochondrial OS=Mus musculus OX=10090 GN=Acsf3 PE=1 SV=2
3	Q4G176	0.0	1184	576	1.000	1.000	ACSF3_HUMAN Malonate--CoA ligase ACSF3, mitochondrial OS=Homo sapiens OX=9606 GN=ACSF3 PE=1 SV=3
4	F5H755	2.39e-172	489	235	0.408	1.000	F5H755_HUMAN Acyl-CoA synthetase family member 3 (Fragment) OS=Homo sapiens OX=9606 GN=ACSF3 PE=1 SV=1
5	F5H362	1.66e-136	396	190	0.330	1.000	F5H362_HUMAN Acyl-CoA synthetase family member 3 (Fragment) OS=Homo sapiens OX=9606 GN=ACSF3 PE=1 SV=1
6	Q8H151	7.47e-122	374	608	0.380	0.360	AAE13_ARATH Malonate--CoA ligase OS=Arabidopsis thaliana OX=3702 GN=AAE13 PE=1 SV=2
7	M4IS90	2.60e-118	365	607	0.398	0.377	CCL8_HUMLU Probable CoA ligase CCL8 OS=Humulus lupulus OX=3486 GN=CCL8 PE=2 SV=1
8	H0YGC7	3.19e-111	331	183	0.278	0.874	H0YGC7_HUMAN Acyl-CoA synthetase family member 3 (Fragment) OS=Homo sapiens OX=9606 GN=ACSF3 PE=1 SV=1
9	Q384Q3	1.87e-84	280	727	0.302	0.239	Q384Q3_TRYB2 Long-chain-fatty-acid-coA ligase protein,putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5520 PE=4 SV=1
10	O74976	4.96e-55	196	512	0.260	0.293	FAT2_SCHPO Oxalate--CoA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pcs60 PE=1 SV=1
11	Q9EY88	8.81e-52	186	491	0.266	0.312	FCS_AMYSP Feruloyl-CoA synthase OS=Amycolatopsis sp. OX=37632 GN=fcs PE=1 SV=1
12	S5M744	8.81e-52	186	491	0.266	0.312	FCS_STRSQ Feruloyl-CoA synthase OS=Streptomyces sp. OX=1931 GN=fcs PE=1 SV=2
13	Q9SMT7	3.38e-51	186	514	0.276	0.309	4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana OX=3702 GN=AAE3 PE=1 SV=1
14	P9WQ37	1.60e-50	183	503	0.257	0.294	FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD13 PE=1 SV=1
15	Q54WL7	4.70e-45	169	542	0.247	0.262	Q54WL7_DICDI AMP-dependent synthetase and ligase domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279561 PE=3 SV=1
16	P38137	6.13e-45	169	543	0.255	0.271	FAT2_YEAST Oxalate--CoA ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PCS60 PE=1 SV=1
17	O53406	8.16e-44	166	543	0.257	0.273	O53406_MYCTU Probable medium chain fatty-acid-CoA ligase FadD14 (Fatty-acid-CoA synthetase) (Fatty-acid-CoA synthase) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD14 PE=1 SV=1
18	A4YDR9	4.00e-41	158	549	0.262	0.275	HBCL2_METS5 4-hydroxybutyrate--CoA ligase 2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_0394 PE=1 SV=1
19	P38135	4.85e-40	155	566	0.271	0.276	FADK_ECOLI Medium-chain fatty-acid--CoA ligase OS=Escherichia coli (strain K12) OX=83333 GN=fadK PE=1 SV=4
20	Q5SKN9	8.77e-39	151	541	0.273	0.290	LCFCS_THET8 Long-chain-fatty-acid--CoA ligase OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=TTHA0604 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00501 AMP-binding	1.7e-79	279.1	AMP-binding enzyme
2	PF13193 AMP-binding_C	3.7e-16	71.2	AMP-binding enzyme C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000479130

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000304592	0.951	Fatty acid synthase
2	9606.ENSP00000387123	0.945	Alpha-aminoadipic semialdehyde dehydrogenase
3	9606.ENSP00000483300	0.937	Acetyl-CoA carboxylase 1
4	9606.ENSP00000244217	0.936	Methylmalonyl-CoA epimerase, mitochondrial
5	9606.ENSP00000290429	0.935	Malonyl-CoA-acyl carrier protein transacylase, mitochondrial
6	9606.ENSP00000346827	0.935	4-trimethylaminobutyraldehyde dehydrogenase
7	9606.ENSP00000262430	0.928	Malonyl-CoA decarboxylase, mitochondrial
8	9606.ENSP00000341044	0.926	Acetyl-CoA carboxylase 2
9	9606.ENSP00000261733	0.922	Aldehyde dehydrogenase, mitochondrial
10	9606.ENSP00000274813	0.922	Methylmalonyl-CoA mutase, mitochondrial
11	9606.ENSP00000366927	0.922	Aldehyde dehydrogenase X, mitochondrial
12	9606.ENSP00000345774	0.918	Fatty aldehyde dehydrogenase
13	9606.ENSP00000363832	0.914	Aldehyde oxidase
14	9606.ENSP00000324343	0.903	Beta-ureidopropionase
15	9606.ENSP00000357873	0.758	Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial
16	9606.ENSP00000312618	0.755	Acyl-CoA dehydrogenase family member 9, mitochondrial
17	9606.ENSP00000333664	0.744	3-ketoacyl-CoA thiolase, peroxisomal
18	9606.ENSP00000359871	0.738	Medium-chain specific acyl-CoA dehydrogenase, mitochondrial
19	9606.ENSP00000242592	0.736	Short-chain specific acyl-CoA dehydrogenase, mitochondrial
20	9606.ENSP00000467579	0.730	WW domain-binding protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016405	1.000	CoA-ligase activity
GO:0005515	0.999	protein binding
GO:0015645	0.998	fatty acid ligase activity
GO:0031957	0.991	very long-chain fatty acid-CoA ligase activity
GO:0004467	0.393	long-chain fatty acid-CoA ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.977	organic substance metabolic process
GO:0044238	0.977	primary metabolic process
GO:0044237	0.977	cellular metabolic process
GO:0044281	0.975	small molecule metabolic process
GO:0006631	0.968	fatty acid metabolic process
GO:0006807	0.956	nitrogen compound metabolic process
GO:1901564	0.909	organonitrogen compound metabolic process
GO:0008610	0.864	lipid biosynthetic process
GO:0006637	0.828	acyl-CoA metabolic process
GO:0034030	0.813	ribonucleoside bisphosphate biosynthetic process
GO:0034033	0.813	purine nucleoside bisphosphate biosynthetic process
GO:0035384	0.809	thioester biosynthetic process
GO:0046390	0.802	ribose phosphate biosynthetic process
GO:0009165	0.802	nucleotide biosynthetic process
GO:1901568	0.753	fatty acid derivative metabolic process
GO:0009056	0.751	catabolic process
GO:0009152	0.721	purine ribonucleotide biosynthetic process
GO:0071616	0.699	acyl-CoA biosynthetic process
GO:1901575	0.668	organic substance catabolic process
GO:0035337	0.659	fatty-acyl-CoA metabolic process
GO:0044283	0.610	small molecule biosynthetic process
GO:0044248	0.578	cellular catabolic process
GO:0044282	0.534	small molecule catabolic process
GO:0046394	0.529	carboxylic acid biosynthetic process
GO:0046395	0.518	carboxylic acid catabolic process
GO:1901570	0.308	fatty acid derivative biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.999	intracellular organelle lumen
GO:0005634	0.989	nucleus
GO:0031981	0.966	nuclear lumen
GO:0005759	0.934	mitochondrial matrix
GO:0005654	0.768	nucleoplasm
GO:0005829	0.317	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.2.1.-	1.000	Acid--thiol ligases.
RHEA:15421	0.393	a long-chain fatty acid + ATP + CoA = a long-chain fatty acyl-CoA + AMP + diphosphate
EC:6.2.1.3	0.393	long-chain-fatty-acid--CoA ligase.

[back to server]