StarFunc result for job id Q4J6C6

User Input

>input (727 residues)
MQQKTKLFLQALKYSIPHLGKCMQKQHLNHYNFADHCYNRIKLKKYHLTKCLQNKPKISE
LARNIPSRSFSCKDLQPVKQENEKPLPENMDAFEKVRTKLETQPQEEYEIINVEVKHGGF
VYYQEGCCLVRSKDEEADNDNYEVLFNLEELKLDQPFIDCIRVAPDEKYVAAKIRTEDSE
ASTCVIIKLSDQPVMEASFPNVSSFEWVKDEEDEDVLFYTFQRNLRCHDVYRATFGDNKR
NERFYTEKDPSYFVFLYLTKDSRFLTINIMNKTTSEVWLIDGLSPWDPPVLIQKRIHGVL
YYVEHRDDELYILTNVGEPTEFKLMRTAADTPAIMNWDLFFTMKRNTKVIDLDMFKDHCV
LFLKHSNLLYVNVIGLADDSVRSLKLPPWACGFIMDTNSDPKNCPFQLCSPIRPPKYYTY
KFAEGKLFEETGHEDPITKTSRVLRLEAKSKDGKLVPMTVFHKTDSEDLQKKPLLVHVYG
AYGMDLKMNFRPERRVLVDDGWILAYCHVRGGGELGLQWHADGRLTKKLNGLADLEACIK
TLHGQGFSQPSLTTLTAFSAGGVLAGALCNSNPELVRAVTLEAPFLDVLNTMMDTTLPLT
LEELEEWGNPSSDEKHKNYIKRYCPYQNIKPQHYPSIHITAYENDERVPLKGIVSYTEKL
KEAIAEHAKDTGEGYQTPNIILDIQPGGNHVIEDSHKKITAQIKFLYEELGLDSTSVFED
LKKYLKF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4J6C6	1.000	1.000	0.000	727	1.000	1.000	Q4J6C6.pdb.gz	PPCEL_HUMAN Prolyl endopeptidase-like OS=Homo sapiens OX=9606 GN=PREPL PE=1 SV=1
2	AFDB:P24555	0.729	0.770	5.637E-50	686	0.213	0.226	P24555.pdb.gz	PTRB_ECOLI Protease 2 OS=Escherichia coli (strain K12) OX=83333 GN=ptrB PE=1 SV=2
3	AFDB:O07834	0.720	0.724	1.231E-48	723	0.202	0.203	O07834.pdb.gz	DAPB1_PSEMX Dipeptidyl aminopeptidase BI OS=Pseudoxanthomonas mexicana OX=128785 GN=dapb1 PE=1 SV=1
4	AFDB:Q9SX53	0.732	0.749	7.274E-48	710	0.224	0.230	Q9SX53.pdb.gz	Q9SX53_ARATH Prolyl endopeptidase OS=Arabidopsis thaliana OX=3702 GN=At1g50380 PE=1 SV=1
5	AFDB:Q57XB0	0.760	0.618	6.198E-47	904	0.220	0.177	Q57XB0.pdb.gz	Q57XB0_TRYB2 Oligopeptidase B protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.26A24.30 PE=3 SV=1
6	PDB:2xe4A	0.721	0.727	2.080E-46	721	0.199	0.201	2xe4A.pdb.gz	Crystal Structure of Leishmania Major Oligopeptidase B Gives Insight Into the Enzymatic Properties of a Trypanosomatid Virulence Factor.
7	AFDB:O76728	0.711	0.723	1.668E-45	715	0.208	0.211	O76728.pdb.gz	O76728_TRYBB Prolyl endopeptidase OS=Trypanosoma brucei brucei OX=5702 GN=opb PE=1 SV=1
8	AFDB:F4I0I5	0.685	0.659	2.963E-45	757	0.228	0.219	F4I0I5.pdb.gz	F4I0I5_ARATH Prolyl endopeptidase OS=Arabidopsis thaliana OX=3702 GN=At1g69020 PE=1 SV=1
9	AFDB:Q4QHU7	0.724	0.720	5.845E-45	731	0.201	0.200	Q4QHU7.pdb.gz	Q4QHU7_LEIMA Prolyl endopeptidase OS=Leishmania major OX=5664 GN=OPB PE=1 SV=1
10	PDB:4bp8A	0.654	0.666	1.044E-43	712	0.209	0.213	4bp8A.pdb.gz
11	PDB:3dduA	0.695	0.714	4.241E-40	707	0.157	0.161	3dduA.pdb.gz	Pyrrolidinyl pyridone and pyrazinone analogues as potent inhibitors of prolyl oligopeptidase (POP)
12	AFDB:Q9VKW5	0.664	0.640	1.474E-39	756	0.164	0.157	Q9VKW5.pdb.gz	Q9VKW5_DROME Prolyl endopeptidase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5355 PE=1 SV=2
13	AFDB:F4HSS5	0.680	0.676	4.416E-39	731	0.176	0.175	F4HSS5.pdb.gz	F4HSS5_ARATH Prolyl endopeptidase OS=Arabidopsis thaliana OX=3702 GN=POQR PE=1 SV=1
14	PDB:4n8eB	0.562	0.558	5.790E-23	734	0.117	0.116	4n8eB.pdb.gz	Discovery of C-(1-aryl-cyclohexyl)-methylamines as selective, orally available inhibitors of dipeptidyl peptidase IV.
15	PDB:6y0fC	0.558	0.561	3.788E-21	722	0.110	0.111	6y0fC.pdb.gz	Structure of human FAPalpha in complex with linagliptin
16	PDB:2gbfA	0.559	0.557	5.182E-21	730	0.122	0.122	2gbfA.pdb.gz	Crystal Structures of DPP-IV (CD26) from Rat Kidney Exhibit Flexible Accommodation of Peptidase-Selective Inhibitors.
17	PDB:7ayqA	0.473	0.433	5.166E-20	808	0.105	0.094	7ayqA.pdb.gz	Chemoproteomics-Enabled Identification of 4-Oxo-beta-Lactams as Inhibitors of Dipeptidyl Peptidases 8 and 9.
18	PDB:4wjlB	0.572	0.577	1.019E-19	719	0.113	0.114	4wjlB.pdb.gz
19	PDB:7jn7A	0.594	0.519	2.118E-19	846	0.110	0.095	7jn7A.pdb.gz	Dipeptidyl peptidase 9 sets a threshold for CARD8 inflammasome formation by sequestering its active C-terminal fragment.
20	PDB:7svmA	0.564	0.492	2.898E-19	852	0.107	0.092	7svmA.pdb.gz	A Phenotypic Screen Identifies Potent DPP9 Inhibitors Capable of Killing HIV-1 Infected Cells.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q4J6C6	0.0	1517	727	1.000	1.000	PPCEL_HUMAN Prolyl endopeptidase-like OS=Homo sapiens OX=9606 GN=PREPL PE=1 SV=1
2	Q8C167	0.0	1368	725	0.909	0.912	PPCEL_MOUSE Prolyl endopeptidase-like OS=Mus musculus OX=10090 GN=Prepl PE=1 SV=1
3	Q9SX53	5.13e-54	200	710	0.206	0.211	Q9SX53_ARATH Prolyl endopeptidase OS=Arabidopsis thaliana OX=3702 GN=At1g50380 PE=1 SV=1
4	P24555	1.06e-52	196	686	0.195	0.207	PTRB_ECOLI Protease 2 OS=Escherichia coli (strain K12) OX=83333 GN=ptrB PE=1 SV=2
5	F4I0I5	2.00e-50	190	757	0.215	0.206	F4I0I5_ARATH Prolyl endopeptidase OS=Arabidopsis thaliana OX=3702 GN=At1g69020 PE=1 SV=1
6	O07834	2.09e-48	184	723	0.176	0.177	DAPB1_PSEMX Dipeptidyl aminopeptidase BI OS=Pseudoxanthomonas mexicana OX=128785 GN=dapb1 PE=1 SV=1
7	Q382P7	3.29e-44	172	715	0.216	0.220	Q382P7_TRYB2 Prolyl endopeptidase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.52.0003 PE=3 SV=1
8	O76728	1.46e-43	170	715	0.215	0.218	O76728_TRYBB Prolyl endopeptidase OS=Trypanosoma brucei brucei OX=5702 GN=opb PE=1 SV=1
9	Q57XB0	3.56e-42	167	904	0.195	0.157	Q57XB0_TRYB2 Oligopeptidase B protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.26A24.30 PE=3 SV=1
10	Q4QHU7	5.74e-34	141	731	0.107	0.107	Q4QHU7_LEIMA Prolyl endopeptidase OS=Leishmania major OX=5664 GN=OPB PE=1 SV=1
11	Q38AG2	7.18e-25	112	698	0.092	0.096	Q38AG2_TRYB2 Prolyl endopeptidase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2520 PE=3 SV=1
12	Q9VKW5	3.42e-22	104	756	0.111	0.107	Q9VKW5_DROME Prolyl endopeptidase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5355 PE=1 SV=2
13	P48147	1.04e-21	102	710	0.151	0.155	PPCE_HUMAN Prolyl endopeptidase OS=Homo sapiens OX=9606 GN=PREP PE=1 SV=2
14	A0A499FJL1	1.06e-21	102	644	0.151	0.171	A0A499FJL1_HUMAN Prolyl endopeptidase OS=Homo sapiens OX=9606 GN=PREP PE=1 SV=1
15	F4I2A0	2.05e-21	102	795	0.183	0.167	F4I2A0_ARATH Prolyl endopeptidase OS=Arabidopsis thaliana OX=3702 GN=At1g76140 PE=1 SV=1
16	Q9QUR6	1.43e-20	99.0	710	0.147	0.151	PPCE_MOUSE Prolyl endopeptidase OS=Mus musculus OX=10090 GN=Prep PE=1 SV=1
17	O70196	1.94e-20	98.6	710	0.144	0.148	PPCE_RAT Prolyl endopeptidase OS=Rattus norvegicus OX=10116 GN=Prep PE=1 SV=1
18	Q9V9P5	1.42e-19	95.9	731	0.102	0.101	Q9V9P5_DROME Prolyl endopeptidase OS=Drosophila melanogaster OX=7227 GN=lincRNA.224 PE=3 SV=4
19	Q961N7	6.65e-18	90.5	639	0.077	0.088	Q961N7_DROME Prolyl endopeptidase OS=Drosophila melanogaster OX=7227 GN=CG5355 PE=2 SV=1
20	F4HSS5	7.94e-18	90.5	731	0.087	0.086	F4HSS5_ARATH Prolyl endopeptidase OS=Arabidopsis thaliana OX=3702 GN=POQR PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00561 Abhydrolase_1	2.9e+02	12.5	alpha/beta hydrolase fold
2	PF04972 BON	7.8e+02	11.8	BON domain
3	PF12146 Hydrolase_4	1.9e+02	12.7	Serine aminopeptidase, S33
4	PF00326 Peptidase_S9	1.2e-26	105.0	Prolyl oligopeptidase family
5	PF02897 Peptidase_S9_N	1.4e-23	95.0	Prolyl oligopeptidase, N-terminal beta-propeller domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386543

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260649	0.916	Neutral and basic amino acid transport protein rBAT
2	9606.ENSP00000367755	0.916	Calmodulin-lysine N-methyltransferase
3	9606.ENSP00000282412	0.912	Protein phosphatase 1B
4	9606.ENSP00000464955	0.777	Pleckstrin homology domain containing J1
5	9606.ENSP00000361032	0.746	Surfeit 2
6	9606.ENSP00000292524	0.719	Leucine-rich repeat-containing protein 14
7	9606.ENSP00000388996	0.699	AP-1 complex subunit mu-1
8	9606.ENSP00000367494	0.689	Protein spire homolog 2
9	9606.ENSP00000359224	0.683	UDP-N-acetylglucosamine transferase subunit ALG14 homolog
10	9606.ENSP00000221494	0.666	Splicing factor 3A subunit 2
11	9606.ENSP00000369559	0.661	Olfactory receptor 51I1
12	9606.ENSP00000320219	0.655	Arylsulfatase family member J
13	9606.ENSP00000346959	0.644	Probable sodium-coupled neutral amino acid transporter 6
14	9606.ENSP00000472847	0.640	Serine--tRNA ligase, mitochondrial
15	9606.ENSP00000336866	0.586	Putative hydrolase RBBP9
16	9606.ENSP00000330875	0.582	Fanconi anemia group F protein
17	9606.ENSP00000392660	0.564	Rho GTPase-activating protein 28
18	9606.ENSP00000285518	0.563	1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon
19	9606.ENSP00000219368	0.562	Fatty acid 2-hydroxylase
20	9606.ENSP00000417764	0.557	Alpha-1,3/1,6-mannosyltransferase ALG2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008233	1.000	peptidase activity
GO:0005488	0.824	binding
GO:0005515	0.542	protein binding
GO:0017171	0.387	serine hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.956	biological regulation
GO:0050789	0.953	regulation of biological process
GO:0050794	0.928	regulation of cellular process
GO:0009987	0.910	cellular process
GO:0051588	0.691	regulation of neurotransmitter transport
GO:0001505	0.688	regulation of neurotransmitter levels
GO:1903305	0.677	regulation of regulated secretory pathway
GO:0099177	0.640	regulation of trans-synaptic signaling
GO:0046928	0.626	regulation of neurotransmitter secretion
GO:2000300	0.622	regulation of synaptic vesicle exocytosis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.991	endomembrane system
GO:0043228	0.991	non-membrane-bounded organelle
GO:0043232	0.982	intracellular non-membrane-bounded organelle
GO:0031984	0.780	organelle subcompartment
GO:0005794	0.710	Golgi apparatus
GO:0005856	0.670	cytoskeleton
GO:0005739	0.626	mitochondrion
GO:0098791	0.527	Golgi apparatus subcompartment
GO:0005802	0.504	trans-Golgi network
GO:0031974	0.457	membrane-enclosed lumen
GO:0070013	0.448	intracellular organelle lumen
GO:0005634	0.357	nucleus
GO:0016020	0.327	membrane
GO:0031981	0.304	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).

[back to server]