StarFunc result for job id Q4KMG0

User Input

>input (1287 residues)
MHPDLGPLCTLLYVTLTILCSSVSSDLAPYFTSEPLSAVQKLGGPVVLHCSAQPVTTRIS
WLHNGKTLDGNLEHVKIHQGTLTILSLNSSLLGYYQCLANNSIGAIVSGPATVSVAVLGD
FGSSTKHVITAEEKSAGFIGCRVPESNPKAEVRYKIRGKWLEHSTENYLILPSGNLQILN
VSLEDKGSYKCAAYNPVTHQLKVEPIGRKLLVSRPSSDDVHILHPTHSQALAVLSRSPVT
LECVVSGVPAPQVYWLKDGQDIAPGSNWRRLYSHLATDSVDPADSGNYSCMAGNKSGDVK
YVTYMVNVLEHASISKGLQDQIVSLGATVHFTCDVHGNPAPNCTWFHNAQPIHPSARHLT
AGNGLKISGVTVEDVGMYQCVADNGIGFMHSTGRLEIENDGGFKPVIITAPVSAKVADGD
FVTLSCNASGLPVPVIRWYDSHGLITSHPSQVLRSKSRKSQLSRPEGLNLEPVYFVLSQA
GASSLHIQAVTQEHAGKYICEAANEHGTTQAEASLMVVPFETNTKAETVTLPDAAQNDDR
SKRDGSETGLLSSFPVKVHPSAVESAPEKNASGISVPDAPIILSPPQTHTPDTYNLVWRA
GKDGGLPINAYFVKYRKLDDGVGMLGSWHTVRVPGSENELHLAELEPSSLYEVLMVARSA
AGEGQPAMLTFRTSKEKTASSKNTQASSPPVGIPKYPVVSEAANNNFGVVLTDSSRHSGV
PEAPDRPTISTASETSVYVTWIPRANGGSPITAFKVEYKRMRTSNWLVAAEDIPPSKLSV
EVRSLEPGSTYKFRVIAINHYGESFRSSASRPYQVVGFPNRFSSRPITGPHIAYTEAVSD
TQIMLKWTYIPSSNNNTPIQGFYIYYRPTDSDNDSDYKRDVVEGSKQWHMIGHLQPETSY
DIKMQCFNEGGESEFSNVMICETKVKRVPGASEYPVKDLSTPPNSLGSGGNVGPATSPAR
SSDMLYLIVGCVLGVMVLILMVFIAMCLWKNRQQNTIQKYDPPGYLYQGSDMNGQMVDYT
TLSGASQINGNVHGGFLTNGGLSSGYSHLHHKVPNAVNGIVNGSLNGGLYSGHSNSLTRT
HVDFEHPHHLVNGGGMYTAVPQIDPLECVNCRNCRNNNRCFTKTNSTFSSSPPPVVPVVA
PYPQDGLEMKPLSHVKVPVCLTSAVPDCGQLPEESVKDNVEPVPTQRTCCQDIVNDVSSD
GSEDPAEFSRGQEGMINLRIPDHLQLAKSCVWEGDSCAHSETEINIVSWNALILPPVPEG
CAEKTMWSPPGIPLDSPTEVLQQPRET

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35158	0.374	0.383	0.000	1256	0.793	0.812	O35158.pdb.gz	CDON_RAT Cell adhesion molecule-related/down-regulated by oncogenes OS=Rattus norvegicus OX=10116 GN=Cdon PE=1 SV=2
2	AFDB:Q4KMG0	1.000	1.000	0.000	1287	1.000	1.000	Q4KMG0.pdb.gz	CDON_HUMAN Cell adhesion molecule-related/down-regulated by oncogenes OS=Homo sapiens OX=9606 GN=CDON PE=1 SV=2
3	AFDB:F1QGR0	0.309	0.382	9.322E-92	1032	0.329	0.410	F1QGR0.pdb.gz
4	AFDB:Q9W213	0.147	0.137	2.497E-65	1395	0.196	0.181	Q9W213.pdb.gz	Q9W213_DROME Roundabout 1, isoform A OS=Drosophila melanogaster OX=7227 GN=robo1 PE=1 SV=3
5	AFDB:G5EBF1	0.193	0.195	1.402E-64	1273	0.204	0.207	G5EBF1.pdb.gz	SAX3_CAEEL Protein sax-3 OS=Caenorhabditis elegans OX=6239 GN=sax-3 PE=2 SV=1
6	AFDB:A0A2R8QRK0	0.195	0.179	8.338E-62	1420	0.191	0.173	A0A2R8QRK0.pdb.gz	A0A2R8QRK0_DANRE Roundabout homolog 3 isoform X3 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1
7	AFDB:F1R2D2	0.191	0.150	1.502E-60	1687	0.196	0.149	F1R2D2.pdb.gz
8	AFDB:P97603	0.277	0.259	1.115E-59	1377	0.197	0.184	P97603.pdb.gz	NEO1_RAT Neogenin (Fragment) OS=Rattus norvegicus OX=10116 GN=Neo1 PE=1 SV=1
9	AFDB:O55005	0.184	0.148	1.620E-59	1651	0.203	0.158	O55005.pdb.gz	ROBO1_RAT Roundabout homolog 1 OS=Rattus norvegicus OX=10116 GN=Robo1 PE=1 SV=1
10	AFDB:A0A0R4IP15	0.207	0.191	5.872E-58	1428	0.206	0.186	A0A0R4IP15.pdb.gz	A0A0R4IP15_DANRE Neogenin 1a OS=Danio rerio OX=7955 GN=cb333 PE=1 SV=1
11	PDB:5oj2B	0.113	0.194	8.569E-28	692	0.110	0.204	5oj2B.pdb.gz
12	PDB:1e07A	0.113	0.196	1.325E-20	642	0.087	0.174	1e07A.pdb.gz
13	PDB:7sqcO0	0.116	0.126	1.006E-15	1140	0.074	0.083	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
14	PDB:6dldD	0.136	0.488	1.604E-15	269	0.056	0.268	6dldD.pdb.gz
15	PDB:7q1yA	0.084	0.080	3.323E-14	1374	0.067	0.063	7q1yA.pdb.gz
16	PDB:5a42A	0.097	0.085	1.954E-13	1597	0.075	0.061	5a42A.pdb.gz
17	PDB:6dlfA	0.124	0.564	9.106E-13	236	0.045	0.246	6dlfA.pdb.gz
18	PDB:7q5zA	0.079	0.078	2.108E-12	1344	0.066	0.063	7q5zA.pdb.gz
19	PDB:6pxvA	0.071	0.108	4.879E-12	823	0.039	0.061	6pxvA.pdb.gz
20	PDB:7vonA	0.080	0.077	5.356E-12	1399	0.075	0.069	7vonA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35158	0.0	2048	1256	0.793	0.813	CDON_RAT Cell adhesion molecule-related/down-regulated by oncogenes OS=Rattus norvegicus OX=10116 GN=Cdon PE=1 SV=2
2	Q1L8D0	0.0	742	1125	0.350	0.400	Q1L8D0_DANRE Cell adhesion molecule-related/down-regulated by oncogenes OS=Danio rerio OX=7955 GN=zgc:158240 PE=2 SV=2
3	Q32MD9	0.0	2077	1250	0.802	0.826	CDON_MOUSE Cell adhesion molecule-related/down-regulated by oncogenes OS=Mus musculus OX=10090 GN=Cdon PE=1 SV=2
4	Q4KMG0	0.0	2660	1287	1.000	1.000	CDON_HUMAN Cell adhesion molecule-related/down-regulated by oncogenes OS=Homo sapiens OX=9606 GN=CDON PE=1 SV=2
5	D4A0Z7	7.07e-149	481	1110	0.281	0.326	D4A0Z7_RAT BOC cell adhesion associated, oncogene regulated OS=Rattus norvegicus OX=10116 GN=Boc PE=4 SV=3
6	Q6AZB0	6.26e-145	470	1110	0.264	0.306	BOC_MOUSE Brother of CDO OS=Mus musculus OX=10090 GN=Boc PE=1 SV=2
7	Q9BWV1	4.57e-141	460	1114	0.260	0.300	BOC_HUMAN Brother of CDO OS=Homo sapiens OX=9606 GN=BOC PE=1 SV=1
8	Q8UVD6	1.39e-136	446	1032	0.253	0.316	Q8UVD6_DANRE Brother of CDO OS=Danio rerio OX=7955 GN=wu:fa16d03 PE=1 SV=1
9	P20241	4.88e-42	171	1302	0.110	0.108	NRG_DROME Neuroglian OS=Drosophila melanogaster OX=7227 GN=Nrg PE=1 SV=2
10	Q9P232	2.04e-41	168	1028	0.167	0.209	CNTN3_HUMAN Contactin-3 OS=Homo sapiens OX=9606 GN=CNTN3 PE=1 SV=3
11	Q62682	2.97e-41	167	1028	0.169	0.212	CNTN3_RAT Contactin-3 OS=Rattus norvegicus OX=10116 GN=Cntn3 PE=1 SV=1
12	G5EBF1	3.51e-41	168	1273	0.139	0.141	SAX3_CAEEL Protein sax-3 OS=Caenorhabditis elegans OX=6239 GN=sax-3 PE=2 SV=1
13	Q62845	1.34e-39	162	1026	0.176	0.220	CNTN4_RAT Contactin-4 OS=Rattus norvegicus OX=10116 GN=Cntn4 PE=1 SV=1
14	Q8AV57	2.03e-39	163	2177	0.121	0.072	SDK2_CHICK Protein sidekick-2 OS=Gallus gallus OX=9031 GN=SDK2 PE=1 SV=2
15	Q8UVD7	2.67e-39	162	1614	0.129	0.103	Q8UVD7_XENLA Roundabout guidance receptor 1 L homeolog precursor OS=Xenopus laevis OX=8355 GN=robo1.L PE=2 SV=1
16	Q8IWV2	3.98e-39	160	1026	0.172	0.216	CNTN4_HUMAN Contactin-4 OS=Homo sapiens OX=9606 GN=CNTN4 PE=1 SV=1
17	P68500	4.23e-39	161	1098	0.173	0.203	CNTN5_MOUSE Contactin-5 OS=Mus musculus OX=10090 GN=Cntn5 PE=1 SV=2
18	O55005	9.59e-39	160	1651	0.176	0.137	ROBO1_RAT Roundabout homolog 1 OS=Rattus norvegicus OX=10116 GN=Robo1 PE=1 SV=1
19	O94779	3.67e-38	158	1100	0.163	0.191	CNTN5_HUMAN Contactin-5 OS=Homo sapiens OX=9606 GN=CNTN5 PE=1 SV=2
20	O89026	1.95e-37	156	1612	0.176	0.140	ROBO1_MOUSE Roundabout homolog 1 OS=Mus musculus OX=10090 GN=Robo1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	4.2	19.1	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	0.00053	31.3	CD80-like C2-set immunoglobulin domain
3	PF00041 fn3	1.7e-34	129.4	Fibronectin type III domain
4	PF03663 Glyco_hydro_76	5.8e+02	11.4	Glycosyl hydrolase family 76
5	PF02480 Herpes_gE	2.4e+02	12.6	Alphaherpesvirus glycoprotein E
6	PF07679 I-set	1.9e-54	193.0	Immunoglobulin I-set domain
7	PF00047 ig	7.1e-35	130.4	Immunoglobulin domain
8	PF13895 Ig_2	8.6e-39	143.0	Immunoglobulin domain
9	PF13927 Ig_3	5.4e-61	214.4	Immunoglobulin domain
10	PF16680 Ig_4	2.8e-05	35.9	T-cell surface glycoprotein CD3 delta chain
11	PF16681 Ig_5	8.6e-06	37.4	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
12	PF18452 Ig_6	0.81	21.0	Immunoglobulin domain
13	PF17736 Ig_C17orf99	3.6	19.0	C17orf99 Ig domain
14	PF09294 Interfer-bind	4e+02	12.7	Interferon-alpha/beta receptor, fibronectin type III
15	PF16706 Izumo-Ig	0.079	24.2	Izumo-like Immunoglobulin domain
16	PF16656 Pur_ac_phosph_N	0.0014	30.5	Purple acid Phosphatase, N-terminal domain
17	PF07686 V-set	3.8e-13	61.0	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376458

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000297261	0.999	Sonic hedgehog protein
2	9606.ENSP00000332353	0.995	Protein patched homolog 1
3	9606.ENSP00000266991	0.992	Desert hedgehog protein
4	9606.ENSP00000298743	0.974	Growth arrest-specific protein 1
5	9606.ENSP00000390436	0.969	Zinc finger protein GLI2
6	9606.ENSP00000295731	0.965	Indian hedgehog protein
7	9606.ENSP00000267859	0.957	BCL2/adenovirus E1B 19 kDa protein-interacting protein 2
8	9606.ENSP00000269141	0.946	Cadherin-2
9	9606.ENSP00000249373	0.941	Smoothened homolog
10	9606.ENSP00000361266	0.924	Protein patched homolog 2
11	9606.ENSP00000468348	0.907	Dual specificity mitogen-activated protein kinase kinase 6
12	9606.ENSP00000418663	0.870	Brother of CDO
13	9606.ENSP00000263816	0.849	Low-density lipoprotein receptor-related protein 2
14	9606.ENSP00000250535	0.819	Cysteine dioxygenase type 1
15	9606.ENSP00000362888	0.814	2-aminoethanethiol dioxygenase
16	9606.ENSP00000361423	0.776	Tyrosine-protein kinase ABL1
17	9606.ENSP00000262965	0.752	Transcription factor E2-alpha
18	9606.ENSP00000341198	0.751	Neogenin
19	9606.ENSP00000344456	0.740	Catenin beta-1
20	9606.ENSP00000289746	0.724	Cadherin-15

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.975	regulation of cellular process
GO:0050896	0.934	response to stimulus
GO:0007155	0.817	cell adhesion
GO:0051716	0.661	cellular response to stimulus
GO:0007154	0.538	cell communication
GO:0007165	0.461	signal transduction
GO:0032501	0.459	multicellular organismal process
GO:0048518	0.459	positive regulation of biological process
GO:0048856	0.458	anatomical structure development
GO:0048522	0.384	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005886	0.988	plasma membrane
GO:0009986	0.784	cell surface
GO:0005622	0.594	intracellular anatomical structure
GO:0062023	0.468	collagen-containing extracellular matrix
GO:0043226	0.391	organelle
GO:0070013	0.383	intracellular organelle lumen
GO:0005737	0.381	cytoplasm
GO:0043227	0.369	membrane-bounded organelle
GO:0043231	0.345	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]