StarFunc result for job id Q4KMQ2

User Input

>input (910 residues)
MKKMSRNVLLQMEEEEDDDDGDIVLENLGQTIVPDLGSLESQHDFRTPEFEEFNGKPDSL
FFNDGQRRIDFVLVYEDESRKETNKKGTNEKQRRKRQAYESNLICHGLQLEATRSVLDDK
LVFVKVHAPWEVLCTYAEIMHIKLPLKPNDLKNRSSAFGTLNWFTKVLSVDESIIKPEQE
FFTAPFEKNRMNDFYIVDRDAFFNPATRSRIVYFILSRVKYQVINNVSKFGINRLVNSGI
YKAAFPLHDCKFRRQSEDPSCPNERYLLYREWAHPRSIYKKQPLDLIRKYYGEKIGIYFA
WLGYYTQMLLLAAVVGVACFLYGYLNQDNCTWSKEVCHPDIGGKIIMCPQCDRLCPFWKL
NITCESSKKLCIFDSFGTLVFAVFMGVWVTLFLEFWKRRQAELEYEWDTVELQQEEQARP
EYEARCTHVVINEITQEEERIPFTAWGKCIRITLCASAVFFWILLIIASVIGIIVYRLSV
FIVFSAKLPKNINGTDPIQKYLTPQTATSITASIISFIIIMILNTIYEKVAIMITNFELP
RTQTDYENSLTMKMFLFQFVNYYSSCFYIAFFKGKFVGYPGDPVYWLGKYRNEECDPGGC
LLELTTQLTIIMGGKAIWNNIQEVLLPWIMNLIGRFHRVSGSEKITPRWEQDYHLQPMGK
LGLFYEYLEMIIQFGFVTLFVASFPLAPLLALVNNILEIRVDAWKLTTQFRRLVPEKAQD
IGAWQPIMQGIAILAVVTNAMIIAFTSDMIPRLVYYWSFSVPPYGDHTSYTMEGYINNTL
SIFKVADFKNKSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIV
MEHVIYSVKFFISYAIPDVSKRTKSKIQREKYLTQKLLHENHLKDMTKNMGVIAERMIEA
VDNNLRPKSE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P9J9	0.940	0.939	0.000	911	0.905	0.905	Q6P9J9.pdb.gz	ANO6_MOUSE Anoctamin-6 OS=Mus musculus OX=10090 GN=Ano6 PE=1 SV=1
2	AFDB:F1QNZ8	0.923	0.923	7.288E-97	910	0.605	0.605	F1QNZ8.pdb.gz	F1QNZ8_DANRE Anoctamin OS=Danio rerio OX=7955 GN=ano6 PE=3 SV=1
3	AFDB:F1M5Z5	0.742	0.843	3.019E-87	799	0.723	0.824	F1M5Z5.pdb.gz	F1M5Z5_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=3 SV=2
4	PDB:8b8kA	0.782	0.956	9.447E-87	741	0.744	0.914	8b8kA.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
5	AFDB:Q75V66	0.872	0.870	3.536E-82	913	0.486	0.484	Q75V66.pdb.gz	ANO5_HUMAN Anoctamin-5 OS=Homo sapiens OX=9606 GN=ANO5 PE=1 SV=1
6	AFDB:Q75UR0	0.882	0.888	4.081E-80	904	0.470	0.473	Q75UR0.pdb.gz	ANO5_MOUSE Anoctamin-5 OS=Mus musculus OX=10090 GN=Ano5 PE=2 SV=1
7	PDB:8b8jA	0.736	0.939	7.499E-80	709	0.712	0.914	8b8jA.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
8	PDB:8b8mB	0.726	0.965	6.732E-75	682	0.689	0.919	8b8mB.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
9	AFDB:Q32M45	0.848	0.809	2.260E-74	955	0.438	0.418	Q32M45.pdb.gz	ANO4_HUMAN Anoctamin-4 OS=Homo sapiens OX=9606 GN=ANO4 PE=2 SV=1
10	AFDB:A2AHL1	0.828	0.770	4.464E-71	981	0.412	0.382	A2AHL1.pdb.gz	ANO3_MOUSE Anoctamin-3 OS=Mus musculus OX=10090 GN=Ano3 PE=1 SV=1
11	PDB:6p47A	0.742	0.922	6.349E-69	725	0.745	0.935	6p47A.pdb.gz
12	PDB:8bc0B	0.672	0.955	7.582E-69	636	0.653	0.934	8bc0B.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
13	AFDB:Q5XXA6	0.828	0.767	5.257E-65	986	0.377	0.348	Q5XXA6.pdb.gz	ANO1_HUMAN Anoctamin-1 OS=Homo sapiens OX=9606 GN=ANO1 PE=1 SV=1
14	AFDB:D4A915	0.831	0.730	7.497E-65	1040	0.382	0.335	D4A915.pdb.gz	D4A915_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano1 PE=3 SV=1
15	AFDB:Q9VDV4	0.825	0.702	9.359E-65	1075	0.388	0.328	Q9VDV4.pdb.gz	Q9VDV4_DROME Anoctamin OS=Drosophila melanogaster OX=7227 GN=subdued PE=2 SV=1
16	PDB:8bc1A	0.553	0.944	1.639E-56	527	0.543	0.937	8bc1A.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
17	PDB:7zk3A	0.721	0.903	9.915E-51	721	0.333	0.420	7zk3A.pdb.gz	Inhibition mechanism of the chloride channel TMEM16A by the pore blocker 1PBC.
18	PDB:7b5dA	0.708	0.909	8.472E-47	701	0.323	0.419	7b5dA.pdb.gz
19	PDB:6r7xA	0.558	0.784	3.016E-23	629	0.190	0.275	6r7xA.pdb.gz	The structural basis of lipid scrambling and inactivation in the endoplasmic reticulum scramblase TMEM16K.
20	PDB:6bgjA	0.427	0.748	3.976E-21	490	0.236	0.439	6bgjA.pdb.gz	Cryo-EM structures of the TMEM16A calcium-activated chloride channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4JCY1	595	1099	0.388	0.321	A0A0B4JCY1_DROME Anoctamin OS=Drosophila melanogaster OX=7227 GN=subdued PE=3 SV=1
2	A0A0B4KGH4	595	950	0.395	0.378	A0A0B4KGH4_DROME Anoctamin OS=Drosophila melanogaster OX=7227 GN=subdued PE=3 SV=1
3	A0A0G2JXB5	561	1002	0.365	0.331	A0A0G2JXB5_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano2 PE=3 SV=2
4	A0A0G2K052	602	1039	0.397	0.347	A0A0G2K052_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano1 PE=1 SV=2
5	A0A0G2K1M7	1660	909	0.888	0.889	A0A0G2K1M7_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
6	A0A8I5Y1S2	1658	924	0.888	0.874	A0A8I5Y1S2_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
7	A0A8I5ZNW7	601	1040	0.395	0.345	A0A8I5ZNW7_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano1 PE=1 SV=1
8	A0A8I5ZRU7	1670	911	0.904	0.903	A0A8I5ZRU7_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
9	A0A8I5ZT68	1257	806	0.700	0.790	A0A8I5ZT68_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
10	A0A8I6AA94	1661	932	0.888	0.867	A0A8I6AA94_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
11	A0A8I6AHD2	1625	865	0.866	0.911	A0A8I6AHD2_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
12	A0A8I6ASC3	1659	888	0.888	0.910	A0A8I6ASC3_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
13	A0A8I6G530	1658	887	0.887	0.910	A0A8I6G530_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
14	A0A8I6GJA0	551	911	0.363	0.362	A0A8I6GJA0_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano2 PE=3 SV=1
15	A0A8I6GL36	566	990	0.380	0.349	A0A8I6GL36_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano1 PE=1 SV=1
16	A2AHL1	665	981	0.412	0.382	ANO3_MOUSE Anoctamin-3 OS=Mus musculus OX=10090 GN=Ano3 PE=1 SV=1
17	D4A915	598	1040	0.395	0.345	D4A915_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano1 PE=3 SV=1
18	F1M0A0	665	981	0.416	0.386	F1M0A0_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano3 PE=3 SV=4
19	F1M3G8	557	936	0.366	0.356	F1M3G8_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano2 PE=3 SV=3
20	F1M5Z5	1260	799	0.715	0.815	F1M5Z5_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04547 Anoctamin	3e-150	512.8	Calcium-activated chloride channel
2	PF16178 Anoct_dimer	1.5e-72	255.4	Dimerisation domain of Ca+-activated chloride-channel, anoctamin
3	PF04145 Ctr	6.1e+02	12.4	Ctr copper transporter family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003825802.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003825799.1	0.695	Neural EGFL like 2
2	9597.XP_003830501.1	0.695	Neural EGFL like 1
3	9597.XP_008951760.1	0.668	XK-related protein 8
4	9597.XP_003826544.1	0.664	Phospholipid scramblase family member 5
5	9597.XP_008960707.1	0.657	May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.
6	9597.XP_003805856.1	0.648	Belongs to the CDC50/LEM3 family.
7	9597.XP_003810270.1	0.619	Receptor for ATP that acts as a ligand-gated ion channel.
8	9597.XP_003822391.1	0.596	Leucine rich repeat containing 8 family member A
9	9597.XP_003813837.1	0.591	Structural component of the gap junctions and the hemichannels
10	9597.XP_003826550.1	0.581	May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.
11	9597.XP_008960870.1	0.573	Receptor for ATP that acts as a ligand-gated ion channel.
12	9597.XP_008950150.1	0.560	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 ESTs, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
13	9597.XP_003821958.1	0.552	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 1 base at 1 genomic stop codon
14	9597.XP_003808186.1	0.540	Chloride nucleotide-sensitive channel 1A
15	9597.XP_008966417.1	0.538	Receptor-type tyrosine-protein phosphatase eta
16	9597.XP_003818647.1	0.534	Belongs to the BI1 family
17	9597.XP_003822794.1	0.534	Belongs to the CD36 family.
18	9597.XP_008973235.1	0.534	Target of Myb protein 1 isoform X1
19	9597.XP_003832522.1	0.532	Voltage-gated hydrogen channel 1
20	9597.XP_003831421.1	0.505	DnaJ heat shock protein family (Hsp40) member C5 beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005229	1.000	intracellular calcium activated chloride channel activity
GO:0005515	0.999	protein binding
GO:0022839	0.999	monoatomic ion gated channel activity
GO:0017128	0.995	phospholipid scramblase activity
GO:0022832	0.995	voltage-gated channel activity
GO:0005244	0.990	voltage-gated monoatomic ion channel activity
GO:0005227	0.981	calcium activated cation channel activity
GO:0042802	0.816	identical protein binding
GO:0046983	0.729	protein dimerization activity
GO:0042803	0.705	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0034762	0.990	regulation of transmembrane transport
GO:0043269	0.988	regulation of monoatomic ion transport
GO:0051050	0.984	positive regulation of transport
GO:0048522	0.975	positive regulation of cellular process
GO:0034764	0.966	positive regulation of transmembrane transport
GO:0034767	0.963	positive regulation of monoatomic ion transmembrane transport
GO:0010959	0.912	regulation of metal ion transport
GO:1904062	0.884	regulation of monoatomic cation transmembrane transport
GO:1904064	0.864	positive regulation of cation transmembrane transport
GO:0043266	0.863	regulation of potassium ion transport
GO:0043268	0.798	positive regulation of potassium ion transport
GO:1901379	0.778	regulation of potassium ion transmembrane transport
GO:1901381	0.773	positive regulation of potassium ion transmembrane transport
GO:0009987	0.633	cellular process
GO:0006810	0.540	transport
GO:0006811	0.447	monoatomic ion transport
GO:0006821	0.319	chloride transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043227	0.756	membrane-bounded organelle
GO:0005622	0.718	intracellular anatomical structure
GO:0043229	0.427	intracellular organelle
GO:0043231	0.421	intracellular membrane-bounded organelle
GO:0005737	0.389	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29823	1.000	chloride(in) = chloride(out)

[back to server]