StarFunc result for job id Q4KWH8

User Input

>input (1693 residues)
MADLEVYKNLSPEKVERCMSVMQSGTQMIKLKRGTKGLVRLFYLDEHRTRLRWRPSRKSE
KAKILIDSIYKVTEGRQSEIFHRQAEGNFDPSCCFTIYHGNHMESLDLITSNPEEARTWI
TGLKYLMAGISDEDSLAKRQRTHDQWVKQTFEEADKNGDGLLNIEEIHQLMHKLNVNLPR
RKVRQMFQEADTDENQGTLTFEEFCVFYKMMSLRRDLYLLLLSYSDKKDHLTVEELAQFL
KVEQKMNNVTTDYCLDIIKKFEVSEENKVKNVLGIEGFTNFMRSPACDIFNPLHHEVYQD
MDQPLCNYYIASSHNTYLTGDQLLSQSKVDMYARVLQEGCRCVEVDCWDGPDGEPVVHHG
YTLTSKILFRDVVETINKHAFVKNEFPVILSIENHCSIQQQRKIAQYLKGIFGDKLDLSS
VDTGECKQLPSPQSLKGKILVKGKKLPYHLGDDAEEGEVSDEDSADEIEDECKFKLHYSN
GTTEHQVESFIRKKLESLLKESQIRDKEDPDSFTVRALLKATHEGLNAHLKQSPDVKESG
KKSHGRSLMTNFGKHKKTTKSRSKSYSTDDEEDTQQSTGKEGGQLYRLGRRRKTMKLCRE
LSDLVVYTNSVAAQDIVDDGTTGNVLSFSETRAHQVVQQKSEQFMIYNQKQLTRIYPSAY
RIDSSNFNPLPYWNAGCQLVALNYQSEGRMMQLNRAKFKANGNCGYVLKPQQMCKGTFNP
FSGDPLPANPKKQLILKVISGQQLPKPPDSMFGDRGEIIDPFVEVEIIGLPVDCCKDQTR
VVDDNGFNPVWEETLTFTVHMPEIALVRFLVWDHDPIGRDFVGQRTVTFSSLVPGYRHVY
LEGLTEASIFVHITINEIYGKWSPLILNPSYTILHFLGATKNRQLQGLKGLFNKNPRHSS
SENNSHYVRKRSIGDRILRRTASAPAKGRKKSKMGFQEMVEIKDSVSEATRDQDGVLRRT
TRSLQARPVSMPVDRNLLGALSLPVSETAKDIEGKENSLAEDKDGRRKGKASIKDPHFLN
FNKKLSSSSSALLHKDTSQGDTIVSTAHMSVTGEQLGMSSPRGGRTTSNATSNCQENPCP
SKSLSPKQHLAPDPVVNPTQDLHGVKIKEKGNPEDFVEGKSILSGSVLSHSNLEIKNLEG
NRGKGRAATSFSLSDVSMLCSDIPDLHSTAILQESVISHLIDNVTLTNENEPGSSISALI
GQFDETNNQALTVVSHLHNTSVMSGHCPLPSLGLKMPIKHGFCKGKSKSSFLCSSPELIA
LSSSETTKHATNTVYETTCTPISKTKPDDDLSSKAKTAALESNLPGSPNTSRGWLPKSPT
KGEDWETLKSCSPASSPDLTLEDVIADPTLCFNSGESSLVEIDGESENLSLTTCEYRREG
TSQLASPLKLKYNQGVVEHFQRGLRNGYCKETLRPSVPEIFNNIQDVKTQSISYLAYQGA
GFVHNHFSDSDAKMFQTCVPQQSSAQDMHVPVPKQLAHLPLPALKLPSPCKSKSLGDLTS
EDIACNFESKYQCISKSFVTTGIRDKKGVTVKTKSLEPIDALTEQLRKLVSFDQEDNCQV
LYSKQDANQLPRALVRKLSSRSQSRVRNIASRAKEKQEANKQKVPNPSNGAGVVLRNKPS
APTPAVNRHSTGSYIAGYLKNTKGGGLEGRGIPEGACTALHYGHVDQFCSDNSVLQTEPS
SDDKPEIYFLLRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2AP18	0.479	0.537	0.000	1501	0.437	0.492	A2AP18.pdb.gz	PLCH2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Mus musculus OX=10090 GN=Plch2 PE=1 SV=2
2	AFDB:O75038	0.471	0.562	0.000	1416	0.424	0.506	O75038.pdb.gz	PLCH2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Homo sapiens OX=9606 GN=PLCH2 PE=1 SV=3
3	AFDB:Q4KWH5	0.520	0.523	0.000	1682	0.857	0.863	Q4KWH5.pdb.gz	PLCH1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Mus musculus OX=10090 GN=Plch1 PE=2 SV=1
4	AFDB:Q4KWH8	1.000	1.000	0.000	1693	1.000	1.000	Q4KWH8.pdb.gz	PLCH1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Homo sapiens OX=9606 GN=PLCH1 PE=1 SV=1
5	PDB:4gnkB	0.361	0.747	5.770E-53	769	0.138	0.303	4gnkB.pdb.gz	Full-length G alpha (q)-phospholipase C-beta 3 structure reveals interfaces of the C-terminal coiled-coil domain.
6	PDB:1cjyA	0.068	0.177	6.684E-8	633	0.017	0.044	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
7	PDB:5izrC	0.065	0.162	6.721E-7	659	0.014	0.036	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
8	AFDB:Q76N89	0.067	0.070	6.753E-7	1606	0.076	0.080	Q76N89.pdb.gz	HECW1_HUMAN E3 ubiquitin-protein ligase HECW1 OS=Homo sapiens OX=9606 GN=HECW1 PE=1 SV=3
9	PDB:5ixcA	0.063	0.151	7.074E-7	684	0.014	0.034	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
10	PDB:5iz5A	0.067	0.146	1.527E-6	757	0.015	0.033	5iz5A.pdb.gz
11	PDB:5iz5B	0.069	0.153	1.527E-6	746	0.015	0.035	5iz5B.pdb.gz
12	AFDB:Q68CZ2	0.070	0.077	6.129E-6	1445	0.097	0.114	Q68CZ2.pdb.gz	TENS3_HUMAN Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=2
13	PDB:4rj9A	0.060	0.561	7.488E-6	161	0.018	0.193	4rj9A.pdb.gz
14	AFDB:Q86UR5	0.056	0.057	9.238E-6	1692	0.071	0.072	Q86UR5.pdb.gz	RIMS1_HUMAN Regulating synaptic membrane exocytosis protein 1 OS=Homo sapiens OX=9606 GN=RIMS1 PE=1 SV=1
15	AFDB:M9PDD2	0.065	0.156	1.024E-5	655	0.050	0.128	M9PDD2.pdb.gz	M9PDD2_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=anon-WO0118547.182 PE=3 SV=1
16	AFDB:M9PDK6	0.063	0.118	1.392E-5	878	0.078	0.150	M9PDK6.pdb.gz	M9PDK6_DROME Uncharacterized protein, isoform F OS=Drosophila melanogaster OX=7227 GN=anon-WO0118547.182 PE=3 SV=1
17	PDB:3nsjA	0.059	0.177	2.089E-5	530	0.015	0.049	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
18	PDB:3qrxA	0.052	0.435	3.314E-5	145	0.017	0.200	3qrxA.pdb.gz	The structure, molecular dynamics, and energetics of centrin-melittin complex.
19	PDB:3pfqA	0.049	0.152	4.283E-5	523	0.014	0.046	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
20	AFDB:P49796	0.054	0.074	9.289E-5	1198	0.096	0.135	P49796.pdb.gz	RGS3_HUMAN Regulator of G-protein signaling 3 OS=Homo sapiens OX=9606 GN=RGS3 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2U3TZV8	0.0	3444	1685	0.980	0.985	A0A2U3TZV8_HUMAN Phosphoinositide phospholipase C OS=Homo sapiens OX=9606 GN=PLCH1 PE=1 SV=1
2	A2AP18	0.0	1244	1501	0.358	0.404	PLCH2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Mus musculus OX=10090 GN=Plch2 PE=1 SV=2
3	O75038	0.0	1253	1416	0.354	0.424	PLCH2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Homo sapiens OX=9606 GN=PLCH2 PE=1 SV=3
4	Q4KWH5	0.0	2909	1682	0.859	0.865	PLCH1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Mus musculus OX=10090 GN=Plch1 PE=2 SV=1
5	Q4KWH8	0.0	3528	1693	1.000	1.000	PLCH1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Homo sapiens OX=9606 GN=PLCH1 PE=1 SV=1
6	Q8K4D7	4.62e-111	370	647	0.145	0.379	PLCZ1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Mus musculus OX=10090 GN=Plcz1 PE=1 SV=1
7	Q5FX52	1.13e-106	357	645	0.142	0.374	PLCZ1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Rattus norvegicus OX=10116 GN=Plcz1 PE=2 SV=1
8	Q8K394	1.15e-100	353	1128	0.112	0.168	PLCL2_MOUSE Inactive phospholipase C-like protein 2 OS=Mus musculus OX=10090 GN=Plcl2 PE=1 SV=2
9	Q9UPR0	1.23e-99	350	1127	0.112	0.168	PLCL2_HUMAN Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2 PE=1 SV=2
10	A2AT91	1.49e-98	341	883	0.147	0.282	A2AT91_MOUSE Phosphoinositide phospholipase C (Fragment) OS=Mus musculus OX=10090 GN=Plcb4 PE=1 SV=1
11	Q5FWA6	1.98e-97	338	892	0.146	0.278	Q5FWA6_MOUSE Phosphoinositide phospholipase C (Fragment) OS=Mus musculus OX=10090 GN=Plcb4 PE=2 SV=1
12	V9GXQ9	2.02e-97	341	1022	0.148	0.245	V9GXQ9_MOUSE Phosphoinositide phospholipase C OS=Mus musculus OX=10090 GN=Plcb4 PE=1 SV=1
13	Q9BRC7	3.45e-97	334	762	0.106	0.235	PLCD4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Homo sapiens OX=9606 GN=PLCD4 PE=1 SV=1
14	C9JEA7	5.91e-97	334	794	0.106	0.225	C9JEA7_HUMAN Phosphoinositide phospholipase C OS=Homo sapiens OX=9606 GN=PLCD4 PE=1 SV=1
15	Q62688	7.05e-96	338	1096	0.117	0.181	PLCL1_RAT Inactive phospholipase C-like protein 1 OS=Rattus norvegicus OX=10116 GN=Plcl1 PE=1 SV=1
16	Q3USB7	3.08e-95	336	1096	0.116	0.179	PLCL1_MOUSE Inactive phospholipase C-like protein 1 OS=Mus musculus OX=10090 GN=Plcl1 PE=1 SV=3
17	Q15111	2.23e-94	334	1095	0.116	0.179	PLCL1_HUMAN Inactive phospholipase C-like protein 1 OS=Homo sapiens OX=9606 GN=PLCL1 PE=1 SV=3
18	F1Q5G9	3.66e-94	325	761	0.102	0.226	F1Q5G9_DANRE Phosphoinositide phospholipase C OS=Danio rerio OX=7955 GN=plcd4a PE=4 SV=1
19	Q91UZ1	6.16e-93	331	1175	0.146	0.210	Q91UZ1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Mus musculus OX=10090 GN=Plcb4 PE=1 SV=1
20	Q9QW07	2.60e-92	329	1175	0.145	0.209	PLCB4_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 OS=Rattus norvegicus OX=10116 GN=Plcb4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	1.5e-12	59.0	C2 domain
2	PF00036 EF-hand_1	2e-06	38.0	EF hand
3	PF14788 EF-hand_10	0.0094	27.2	EF hand
4	PF12763 EF-hand_4	35	15.8	Cytoskeletal-regulatory complex EF hand
5	PF13202 EF-hand_5	0.03	25.0	EF hand
6	PF13405 EF-hand_6	0.00053	30.6	EF-hand domain
7	PF13499 EF-hand_7	7.6e-08	44.0	EF-hand domain pair
8	PF13833 EF-hand_8	0.061	24.4	EF-hand domain pair
9	PF09279 EF-hand_like	1.9e-13	62.0	Phosphoinositide-specific phospholipase C, efhand-like
10	PF00169 PH	14	17.6	PH domain
11	PF16457 PH_12	0.0095	27.9	Pleckstrin homology domain
12	PF00388 PI-PLC-X	5.1e-60	212.7	Phosphatidylinositol-specific phospholipase C, X domain
13	PF00387 PI-PLC-Y	3.7e-35	132.1	Phosphatidylinositol-specific phospholipase C, Y domain
14	PF10591 SPARC_Ca_bdg	1.3e+02	14.4	Secreted protein acidic and rich in cysteine Ca binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000345988

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000373399	0.942	Phosphatidylinositol 4-phosphate 5-kinase-like protein 1
2	9606.ENSP00000357883	0.933	Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha
3	9606.ENSP00000466363	0.932	Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma
4	9606.ENSP00000265382	0.931	Phosphatidylinositol 4-phosphate 5-kinase type-1 beta
5	9606.ENSP00000347032	0.919	Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma
6	9606.ENSP00000365757	0.919	Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha
7	9606.ENSP00000482548	0.919	Phosphatidylinositol 5-phosphate 4-kinase type-2 beta
8	9606.ENSP00000360777	0.826	72 kDa inositol polyphosphate 5-phosphatase
9	9606.ENSP00000362115	0.798	Type II inositol 1,4,5-trisphosphate 5-phosphatase
10	9606.ENSP00000347792	0.794	Synaptojanin-2
11	9606.ENSP00000357583	0.791	Type I inositol 1,4,5-trisphosphate 5-phosphatase
12	9606.ENSP00000409667	0.786	Synaptojanin-1
13	9606.ENSP00000360154	0.777	Inositol polyphosphate 5-phosphatase OCRL-1
14	9606.ENSP00000363046	0.727	Inositol polyphosphate multikinase
15	9606.ENSP00000333262	0.704	Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A
16	9606.ENSP00000413937	0.696	Inositol polyphosphate 5-phosphatase K
17	9606.ENSP00000263967	0.686	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
18	9606.ENSP00000289153	0.686	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
19	9606.ENSP00000352121	0.686	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
20	9606.ENSP00000366563	0.686	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004629	1.000	phospholipase C activity
GO:0005488	0.995	binding
GO:0005515	0.974	protein binding
GO:0050429	0.562	calcium-dependent phospholipase C activity
GO:0098772	0.345	molecular function regulator activity
GO:0030234	0.313	enzyme regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0035556	0.955	intracellular signal transduction
GO:0048017	0.863	inositol lipid-mediated signaling
GO:0008152	0.812	metabolic process
GO:0044237	0.786	cellular metabolic process
GO:0071704	0.725	organic substance metabolic process
GO:0044238	0.712	primary metabolic process
GO:0006796	0.658	phosphate-containing compound metabolic process
GO:0048015	0.555	phosphatidylinositol-mediated signaling
GO:0006629	0.525	lipid metabolic process
GO:0046486	0.496	glycerolipid metabolic process
GO:0019637	0.463	organophosphate metabolic process
GO:0006644	0.441	phospholipid metabolic process
GO:0006650	0.433	glycerophospholipid metabolic process
GO:0046488	0.411	phosphatidylinositol metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	1.000	cytoplasm
GO:0005829	0.987	cytosol
GO:0005886	0.985	plasma membrane
GO:0043227	0.979	membrane-bounded organelle
GO:0043231	0.973	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.4.-	1.000	Phosphoric diester hydrolases.

[back to server]