StarFunc result for job id Q4L235

User Input

>input (1098 residues)
MTLQELVHKAASCYMDRVAVCFDECNNQLPVYYTYKTVVNAASELSNFLLLHCDFQGIRE
IGLYCQPGIDLPSWILGILQVPAAYVPIEPDSPPSLSTHFMKKCNLKYILVEKKQINKFK
SFHETLLNYDTFTVEHNDLVLFRLHWKNTEVNLMLNDGKEKYEKEKIKSISSEHVNEEKA
EEHMDLRLKHCLAYVLHTSGTTGIPKIVRVPHKCIVPNIQHFRVLFDITQEDVLFLASPL
TFDPSVVEIFLALSSGASLLIVPTSVKLLPSKLASVLFSHHRVTVLQATPTLLRRFGSQL
IKSTVLSATTSLRVLALGGEAFPSLTVLRSWRGEGNKTQIFNVYGITEVSSWATIYRIPE
KTLNSTLKCELPVQLGFPLLGTVVEVRDTNGFTIQEGSGQVFLGGRNRVCFLDDEVTVPL
GTMRATGDFVTVKDGEIFFLGRKDSQIKRHGKRLNIELVQQVAEELQQVESCAVTWYNQE
KLILFMVSKDASVKEYIFKELQKYLPSHAVPDELVLIDSLPFTSHGKIDVSELNKIYLNY
INLKSENKLSGKEDLWEKLQYLWKSTLNLPEDLLRVPDESLFLNSGGDSLKSIRLLSEIE
KLVGTSVPGLLEIILSSSILEIYNHILQTVVPDEDVTFRKSCATKRKLSDINQEEASGTS
LHQKAIMTFTCHNEINAFVVLSRGSQILSLNSTRFLTKLGHCSSACPSDSVSQTNIQNLK
GLNSPVLIGKSKDPSCVAKVSEEGKPAIGTQKMELHVRWRSDTGKCVDASPLVVIPTFDK
SSTTVYIGSHSHRMKAVDFYSGKVKWEQILGDRIESSACVSKCGNFIVVGCYNGLVYVLK
SNSGEKYWMFTTEDAVKSSATMDPTTGLIYIGSHDQHAYALDIYRKKCVWKSKCGGTVFS
SPCLNLIPHHLYFATLGGLLLAVNPATGNVIWKHSCGKPLFSSPQCCSQYICIGCVDGNL
LCFTHFGEQVWQFSTSGPIFSSPCTSPSEQKIFFGSHDCFIYCCNMKGHLQWKFETTSRV
YATPFAFHNYNGSNEMLLAAASTDGKVWILESQSGQLQSVYELPGEVFSSPVVLESMLII
GCRDNYVYCLDLLGGNQK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q80WC9	0.544	0.543	0.000	1100	0.725	0.724	Q80WC9.pdb.gz	ACSF4_MOUSE Beta-alanine-activating enzyme OS=Mus musculus OX=10090 GN=Aasdh PE=1 SV=1
2	AFDB:Q9I182	0.393	0.182	2.325E-37	2448	0.139	0.062	Q9I182.pdb.gz	Q9I182_PSEAE Pyoverdine synthetase D OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pvdD PE=4 SV=1
3	AFDB:P9WQ63	0.312	0.246	7.637E-35	1414	0.127	0.098	P9WQ63.pdb.gz	MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mbtB PE=1 SV=1
4	AFDB:Q9I181	0.327	0.172	8.493E-35	2157	0.120	0.061	Q9I181.pdb.gz	Q9I181_PSEAE PvdJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pvdJ PE=4 SV=2
5	PDB:5ja2A	0.324	0.290	1.531E-33	1238	0.121	0.107	5ja2A.pdb.gz	Structures of a Nonribosomal Peptide Synthetase Module Bound to MbtH-like Proteins Support a Highly Dynamic Domain Architecture.
6	AFDB:P11454	0.326	0.280	1.071E-32	1293	0.120	0.102	P11454.pdb.gz	ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) OX=83333 GN=entF PE=1 SV=3
7	AFDB:A0A1D8PCV7	0.330	0.263	3.837E-32	1404	0.125	0.098	A0A1D8PCV7.pdb.gz	A0A1D8PCV7_CANAL Alpha-aminoadipate reductase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=LYS2 PE=3 SV=1
8	AFDB:Q4WYG2	0.318	0.165	8.077E-32	2202	0.126	0.063	Q4WYG2.pdb.gz	NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=NRPS5 PE=3 SV=2
9	AFDB:Q5W263	0.309	0.659	5.191E-31	491	0.115	0.257	Q5W263.pdb.gz	PIGI_SERS3 L-proline--[L-prolyl-carrier protein] ligase OS=Serratia sp. (strain ATCC 39006) OX=104623 GN=pigI PE=1 SV=1
10	AFDB:C8V7P4	0.317	0.210	9.316E-31	1704	0.121	0.078	C8V7P4.pdb.gz	IVOA_EMENI Nonribosomal peptide synthetase ivoA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ivoA PE=1 SV=1
11	AFDB:Q4WMJ7	0.368	0.197	1.093E-30	2135	0.112	0.058	Q4WMJ7.pdb.gz	GLIP_ASPFU Nonribosomal peptide synthetase gliP OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=gliP PE=1 SV=1
12	PDB:5ie2A	0.379	0.778	5.043E-28	506	0.085	0.184	5ie2A.pdb.gz	Crystal Structures of Arabidopsis thaliana Oxalyl-CoA Synthetase Essential for Oxalate Degradation
13	PDB:1ultA	0.332	0.636	4.702E-27	533	0.102	0.210	1ultA.pdb.gz
14	PDB:3rg2C	0.296	0.506	5.333E-25	613	0.108	0.194	3rg2C.pdb.gz	Structural and Functional Investigation of the Intermolecular Interaction between NRPS Adenylation and Carrier Protein Domains.
15	PDB:1ry2A	0.371	0.630	1.248E-24	615	0.100	0.179	1ry2A.pdb.gz	Crystal structure of yeast acetyl-coenzyme A synthetase in complex with AMP
16	PDB:6q2mA	0.360	0.691	1.519E-23	544	0.095	0.191	6q2mA.pdb.gz	Mutagenesis and Structural Studies Reveal the Basis for the Activity and Stability Properties That Distinguish thePhotinusLuciferasesscintillansandpyralis.
17	PDB:7kydA	0.367	0.721	2.584E-23	534	0.087	0.178	7kydA.pdb.gz	FruitFire: a luciferase based on a fruit fly metabolic enzyme.
18	PDB:5bsmA	0.364	0.715	2.874E-23	530	0.088	0.183	5bsmA.pdb.gz	Structural Basis for Specificity and Flexibility in a Plant 4-Coumarate:CoA Ligase.
19	PDB:3b7wA	0.311	0.601	1.207E-22	537	0.083	0.169	3b7wA.pdb.gz	Structural snapshots for the conformation-dependent catalysis by human medium-chain acyl-coenzyme A synthetase ACSM2A.
20	PDB:3r44A	0.323	0.650	1.575E-22	502	0.082	0.179	3r44A.pdb.gz	The Mycobacterium tuberculosis Very-Long-Chain Fatty Acyl-CoA Synthetase: Structural Basis for Housing Lipid Substrates Longer than the Enzyme.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80WC9	0.0	1639	1100	0.728	0.726	ACSF4_MOUSE Beta-alanine-activating enzyme OS=Mus musculus OX=10090 GN=Aasdh PE=1 SV=1
2	Q4KET0	5.27e-33	142	4367	0.128	0.032	Q4KET0_PSEF5 Non-ribosomal peptide synthetase OfaB OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=ofaB PE=4 SV=2
3	Q51338	6.45e-33	141	2448	0.143	0.064	Q51338_PSEAI Pyoverdine synthetase D OS=Pseudomonas aeruginosa OX=287 GN=pvdD PE=4 SV=1
4	Q9I182	7.20e-33	141	2448	0.143	0.064	Q9I182_PSEAE Pyoverdine synthetase D OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pvdD PE=4 SV=1
5	Q6DNE7	4.94e-31	135	3195	0.130	0.045	Q6DNE7_9CYAN 3-hydroxyacyl-CoA dehydrogenase OS=Lyngbya majuscula OX=158786 GN=curF PE=1 SV=1
6	O76858	2.06e-28	125	879	0.148	0.185	O76858_DROME Ebony protein OS=Drosophila melanogaster OX=7227 GN=e PE=4 SV=1
7	Q9VDC6	2.11e-28	125	879	0.145	0.181	EBO_DROME Beta-alanyl-bioamine nonribosomal peptide synthetase ebony OS=Drosophila melanogaster OX=7227 GN=e PE=1 SV=1
8	Q4KES9	2.53e-26	120	4901	0.124	0.028	Q4KES9_PSEF5 Non-ribosomal peptide synthetase OfaC OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=ofaC PE=4 SV=3
9	Q0VZ70	9.82e-26	118	3912	0.133	0.037	CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus OX=52 GN=cmdD PE=1 SV=1
10	P9WQ63	1.49e-25	117	1414	0.107	0.083	MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mbtB PE=1 SV=1
11	Q10896	1.02e-24	114	2512	0.111	0.049	INLPA_MYCTU Isonitrile lipopeptide synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=nrp PE=1 SV=1
12	B6HLU1	4.59e-24	112	3746	0.141	0.041	ACVA_PENRW N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=acvA PE=1 SV=2
13	P19787	4.59e-24	112	3746	0.141	0.041	ACVA_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum OX=5076 GN=acvA PE=1 SV=1
14	Q9I157	6.04e-24	112	4342	0.130	0.033	Q9I157_PSEAE PvdL OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pvdL PE=4 SV=1
15	Q9I181	1.41e-23	110	2157	0.122	0.062	Q9I181_PSEAE PvdJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pvdJ PE=4 SV=2
16	Q5W263	2.90e-22	103	491	0.096	0.214	PIGI_SERS3 L-proline--[L-prolyl-carrier protein] ligase OS=Serratia sp. (strain ATCC 39006) OX=104623 GN=pigI PE=1 SV=1
17	P11454	3.37e-22	106	1293	0.117	0.100	ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) OX=83333 GN=entF PE=1 SV=3
18	P27742	5.07e-22	105	3770	0.149	0.044	ACVA_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=acvA PE=1 SV=2
19	Q70AZ6	5.42e-22	105	1865	0.105	0.062	Q70AZ6_ACTTI Non-ribosomal peptide synthetase OS=Actinoplanes teichomyceticus OX=1867 GN=tcp12 PE=1 SV=1
20	E0SMH6	4.45e-21	102	1488	0.097	0.071	E0SMH6_DICD3 Indigoidine synthase OS=Dickeya dadantii (strain 3937) OX=198628 GN=indC PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00501 AMP-binding	9.7e-47	171.2	AMP-binding enzyme
2	PF13193 AMP-binding_C	0.66	22.3	AMP-binding enzyme C-terminal domain
3	PF12894 ANAPC4_WD40	0.15	23.7	Anaphase-promoting complex subunit 4 WD40 domain
4	PF08189 Meleagrin	1.3e+02	13.8	Meleagrin/Cygnin family
5	PF00550 PP-binding	0.0056	28.3	Phosphopantetheine attachment site
6	PF01011 PQQ	3.6e-16	69.3	PQQ enzyme repeat
7	PF13360 PQQ_2	2.8e-12	58.4	PQQ-like domain
8	PF13570 PQQ_3	2.9e-29	112.0	PQQ-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000205214

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000278618	0.986	L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
2	9606.ENSP00000458770	0.895	Acyl carrier protein, mitochondrial
3	9606.ENSP00000377040	0.838	Alpha-aminoadipic semialdehyde synthase, mitochondrial
4	9606.ENSP00000371253	0.794	Trifunctional purine biosynthetic protein adenosine-3
5	9606.ENSP00000345445	0.785	Sorting and assembly machinery component 50 homolog
6	9606.ENSP00000438468	0.779	Protein-cysteine N-palmitoyltransferase HHAT
7	9606.ENSP00000405423	0.775	Protein-cysteine N-palmitoyltransferase HHAT-like protein
8	9606.ENSP00000219599	0.766	Ketimine reductase mu-crystallin
9	9606.ENSP00000325448	0.740	Lysine--tRNA ligase
10	9606.ENSP00000382595	0.722	Multifunctional protein ADE2
11	9606.ENSP00000423190	0.707	Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial
12	9606.ENSP00000377668	0.702	Sulfite oxidase, mitochondrial
13	9606.ENSP00000360515	0.649	Transcription initiation protein SPT3 homolog
14	9606.ENSP00000373570	0.636	5,6-dihydroxyindole-2-carboxylic acid oxidase
15	9606.ENSP00000304592	0.610	Fatty acid synthase
16	9606.ENSP00000352268	0.610	Arylacetamide deacetylase-like 3
17	9606.ENSP00000247970	0.607	Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
18	9606.ENSP00000362773	0.607	Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4
19	9606.ENSP00000216254	0.603	Aconitate hydratase, mitochondrial
20	9606.ENSP00000478104	0.586	Vacuolar protein sorting 13 homolog D

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016874	0.995	ligase activity
GO:0042802	0.518	identical protein binding
GO:0016877	0.447	ligase activity, forming carbon-sulfur bonds
GO:0016878	0.436	acid-thiol ligase activity
GO:0036094	0.350	small molecule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0044237	0.998	cellular metabolic process
GO:1901564	0.997	organonitrogen compound metabolic process
GO:0044281	0.991	small molecule metabolic process
GO:0006520	0.966	amino acid metabolic process
GO:0009058	0.950	biosynthetic process
GO:0044271	0.937	cellular nitrogen compound biosynthetic process
GO:0043603	0.926	amide metabolic process
GO:1901576	0.918	organic substance biosynthetic process
GO:1901566	0.886	organonitrogen compound biosynthetic process
GO:0043038	0.839	amino acid activation
GO:0006518	0.783	peptide metabolic process
GO:0043604	0.643	amide biosynthetic process
GO:0043043	0.484	peptide biosynthetic process
GO:1901360	0.407	organic cyclic compound metabolic process
GO:0006725	0.315	cellular aromatic compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.989	cytosol
GO:0043229	0.968	intracellular organelle
GO:0043227	0.965	membrane-bounded organelle
GO:0043231	0.959	intracellular membrane-bounded organelle
GO:0016020	0.916	membrane
GO:0043233	0.409	organelle lumen
GO:0070013	0.337	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.-.-.-	0.995	Ligases.
EC:6.2.-.-	0.447	Forming carbon-sulfur bonds.
EC:6.2.1.-	0.436	Acid--thiol ligases.

[back to server]