StarFunc result for job id Q4LDE5

User Input

>input (1400 residues)
MWPRLAFCCWGLALVSGWATFQQMSPSRNFSFRLFPETAPGAPGSIPAPPAPGDEAAGSR
VERLGQAFRRRVRLLRELSERLELVFLVDDSSSVGEVNFRSELMFVRKLLSDFPVVPTAT
RVAIVTFSSKNYVVPRVDYISTRRARQHKCALLLQEIPAISYRGGGTYTKGAFQQAAQIL
LHARENSTKVVFLITDGYSNGGDPRPIAASLRDSGVEIFTFGIWQGNIRELNDMASTPKE
EHCYLLHSFEEFEALARRALHEDLPSGSFIQDDMVHCSYLCDEGKDCCDRMGSCKCGTHT
GHFECICEKGYYGKGLQYECTACPSGTYKPEGSPGGISSCIPCPDENHTSPPGSTSPEDC
VCREGYRASGQTCELVHCPALKPPENGYFIQNTCNNHFNAACGVRCHPGFDLVGSSIILC
LPNGLWSGSESYCRVRTCPHLRQPKHGHISCSTREMLYKTTCLVACDEGYRLEGSDKLTC
QGNSQWDGPEPRCVERHCSTFQMPKDVIISPHNCGKQPAKFGTICYVSCRQGFILSGVKE
MLRCTTSGKWNVGVQAAVCKDVEAPQINCPKDIEAKTLEQQDSANVTWQIPTAKDNSGEK
VSVHVHPAFTPPYLFPIGDVAIVYTATDLSGNQASCIFHIKVIDAEPPVIDWCRSPPPVQ
VSEKVHAASWDEPQFSDNSGAELVITRSHTQGDLFPQGETIVQYTATDPSGNNRTCDIHI
VIKGSPCEIPFTPVNGDFICTPDNTGVNCTLTCLEGYDFTEGSTDKYYCAYEDGVWKPTY
TTEWPDCAKKRFANHGFKSFEMFYKAARCDDTDLMKKFSEAFETTLGKMVPSFCSDAEDI
DCRLEENLTKKYCLEYNYDYENGFAIGPGGWGAANRLDYSYDDFLDTVQETATSIGNAKS
SRIKRSAPLSDYKIKLIFNITASVPLPDERNDTLEWENQQRLLQTLETITNKLKRTLNKD
PMYSFQLASEILIADSNSLETKKASPFCRPGSVLRGRMCVNCPLGTYYNLEHFTCESCRI
GSYQDEEGQLECKLCPSGMYTEYIHSRNISDCKAQCKQGTYSYSGLETCESCPLGTYQPK
FGSRSCLSCPENTSTVKRGAVNISACGVPCPEGKFSRSGLMPCHPCPRDYYQPNAGKAFC
LACPFYGTTPFAGSRSITECSSFSSTFSAAEESVVPPASLGHIKKRHEISSQVFHECFFN
PCHNSGTCQQLGRGYVCLCPLGYTGLKCETDIDECSPLPCLNNGVCKDLVGEFICECPSG
YTGQRCEENINECSSSPCLNKGICVDGVAGYRCTCVKGFVGLHCETEVNECQSNPCLNNA
VCEDQVGGFLCKCPPGFLGTRCGKNVDECLSQPCKNGATCKDGANSFRCLCAAGFTGSHC
ELNINECQSNPCRNQATCVD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:M1FTT7	0.087	0.107	1.819E-25	1024	0.121	0.165	M1FTT7.pdb.gz
2	AFDB:P98106	0.101	0.176	2.366E-25	768	0.082	0.150	P98106.pdb.gz	LYAM3_RAT P-selectin OS=Rattus norvegicus OX=10116 GN=Selp PE=2 SV=1
3	AFDB:Q9UM47	0.077	0.050	6.424E-25	2321	0.096	0.058	Q9UM47.pdb.gz	NOTC3_HUMAN Neurogenic locus notch homolog protein 3 OS=Homo sapiens OX=9606 GN=NOTCH3 PE=1 SV=2
4	AFDB:F1RCH4	0.120	0.072	8.806E-25	2475	0.163	0.092	F1RCH4.pdb.gz	F1RCH4_DANRE Neurogenic locus notch homolog protein 2 precursor OS=Danio rerio OX=7955 GN=notch6 PE=3 SV=1
5	AFDB:Q5G872	0.073	0.091	8.806E-25	1010	0.126	0.175	Q5G872.pdb.gz	SCUB2_DANRE Signal peptide, CUB and EGF-like domain-containing protein 2 OS=Danio rerio OX=7955 GN=scube2 PE=2 SV=1
6	AFDB:Q6NZL8	0.078	0.095	2.152E-24	1018	0.123	0.169	Q6NZL8.pdb.gz	SCUB1_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Mus musculus OX=10090 GN=Scube1 PE=2 SV=2
7	AFDB:A0A0R4IBT9	0.074	0.094	3.278E-24	994	0.127	0.179	A0A0R4IBT9.pdb.gz	A0A0R4IBT9_DANRE Signal peptide, CUB and EGF-like domain-containing protein 1 isoform 2 precursor OS=Danio rerio OX=7955 GN=im:7427863 PE=4 SV=1
8	AFDB:A0A2R8Q191	0.081	0.105	3.278E-24	1002	0.131	0.184	A0A2R8Q191.pdb.gz
9	AFDB:O35516	0.087	0.053	5.545E-24	2473	0.169	0.096	O35516.pdb.gz	NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus OX=10090 GN=Notch2 PE=1 SV=2
10	AFDB:Q8IWY4	0.080	0.104	7.601E-24	988	0.129	0.182	Q8IWY4.pdb.gz	SCUB1_HUMAN Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SCUBE1 PE=1 SV=3
11	PDB:2gsxA	0.064	0.086	1.923E-16	951	0.077	0.114	2gsxA.pdb.gz
12	PDB:4nehA	0.126	0.160	1.768E-14	1084	0.081	0.105	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
13	PDB:2q7zA	0.066	0.056	1.526E-13	1931	0.070	0.051	2q7zA.pdb.gz
14	PDB:4nenA	0.128	0.165	1.608E-13	1063	0.078	0.103	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
15	PDB:1c1zA	0.094	0.373	2.867E-13	326	0.039	0.166	1c1zA.pdb.gz
16	PDB:1haqA	0.083	0.093	2.048E-10	1213	0.064	0.073	1haqA.pdb.gz
17	PDB:8a7eC	0.076	0.070	3.119E-10	1524	0.054	0.049	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
18	PDB:8a7dQ	0.070	0.219	2.324E-8	273	0.031	0.161	8a7dQ.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
19	PDB:2xwbF	0.047	0.086	5.680E-8	714	0.033	0.064	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.
20	PDB:3t5oA	0.075	0.117	2.252E-6	871	0.035	0.056	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1D5NSM8	0.0	1619	3615	0.554	0.215	A0A1D5NSM8_DANRE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing 1 OS=Danio rerio OX=7955 GN=svep1 PE=4 SV=1
2	A2AVA0	0.0	2412	3567	0.832	0.327	SVEP1_MOUSE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Mus musculus OX=10090 GN=Svep1 PE=1 SV=1
3	Q4LDE5	0.0	2890	3571	1.000	0.392	SVEP1_HUMAN Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SVEP1 PE=1 SV=3
4	E1JHA6	4.57e-94	339	3589	0.191	0.074	E1JHA6_DROME Uninflatable, isoform C OS=Drosophila melanogaster OX=7227 GN=uif PE=1 SV=1
5	Q9VM55	4.93e-94	338	3557	0.191	0.075	Q9VM55_DROME Uninflatable, isoform B OS=Drosophila melanogaster OX=7227 GN=uif PE=1 SV=3
6	Q20531	1.81e-83	305	3514	0.179	0.071	Q20531_CAEEL C-type LECtin OS=Caenorhabditis elegans OX=6239 GN=clec-78 PE=1 SV=2
7	Q9QW30	2.46e-56	218	2471	0.074	0.042	NOTC2_RAT Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus OX=10116 GN=Notch2 PE=1 SV=1
8	P07207	3.26e-56	218	2703	0.071	0.037	NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster OX=7227 GN=N PE=1 SV=3
9	A0PGH6	1.12e-55	216	2465	0.069	0.039	A0PGH6_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio OX=7955 GN=wu:fc55e11 PE=2 SV=1
10	O35516	2.07e-55	215	2473	0.074	0.042	NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus OX=10090 GN=Notch2 PE=1 SV=2
11	Q04721	2.29e-54	212	2471	0.073	0.041	NOTC2_HUMAN Neurogenic locus notch homolog protein 2 OS=Homo sapiens OX=9606 GN=NOTCH2 PE=1 SV=3
12	Q01705	9.46e-53	207	2531	0.088	0.049	NOTC1_MOUSE Neurogenic locus notch homolog protein 1 OS=Mus musculus OX=10090 GN=Notch1 PE=1 SV=3
13	P46531	1.20e-52	206	2555	0.088	0.048	NOTC1_HUMAN Neurogenic locus notch homolog protein 1 OS=Homo sapiens OX=9606 GN=NOTCH1 PE=1 SV=4
14	Q90Y54	2.04e-52	204	1213	0.066	0.077	JAG1B_DANRE Protein jagged-1b OS=Danio rerio OX=7955 GN=jag1b PE=2 SV=1
15	A2RUV0	2.53e-52	205	2522	0.088	0.049	NOTC1_XENTR Neurogenic locus notch homolog protein 1 OS=Xenopus tropicalis OX=8364 GN=notch1 PE=1 SV=2
16	Q800E4	1.22e-51	203	2468	0.074	0.042	Q800E4_DANRE Neurogenic locus notch homolog protein 3 precursor OS=Danio rerio OX=7955 GN=fa14b08 PE=1 SV=1
17	B8JI71	1.30e-51	203	2904	0.069	0.033	EYS_DANRE Protein eyes shut homolog OS=Danio rerio OX=7955 GN=eys PE=1 SV=2
18	P21783	1.33e-51	203	2524	0.067	0.037	NOTC1_XENLA Neurogenic locus notch homolog protein 1 OS=Xenopus laevis OX=8355 GN=notch1 PE=1 SV=3
19	G3I6Z6	2.02e-51	202	2527	0.072	0.040	NOTC1_CRIGR Neurogenic locus notch homolog protein 1 OS=Cricetulus griseus OX=10029 GN=NOTCH1 PE=1 SV=2
20	Q07008	4.66e-51	201	2531	0.072	0.040	NOTC1_RAT Neurogenic locus notch homolog protein 1 OS=Rattus norvegicus OX=10116 GN=Notch1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15418 DUF4625	14	17.4	Domain of unknown function (DUF4625)
2	PF20351 DUF6646	6.9e+02	11.4	Family of unknown function (DUF6646)
3	PF00008 EGF	2.5e-31	118.9	EGF-like domain
4	PF07974 EGF_2	3.9	19.2	EGF-like domain
5	PF12947 EGF_3	44	15.7	EGF domain
6	PF07645 EGF_CA	0.0027	29.2	Calcium-binding EGF domain
7	PF07699 Ephrin_rec_like	8.6e-53	187.2	Tyrosine-protein kinase ephrin type A/B receptor-like
8	PF12661 hEGF	1.3e-16	71.7	Human growth factor-like EGF
9	PF02494 HYR	2.6e-28	109.5	HYR domain
10	PF00084 Sushi	2.3e-19	80.9	Sushi repeat (SCR repeat)
11	PF00092 VWA	3.8e-31	120.2	von Willebrand factor type A domain
12	PF13519 VWA_2	4.2e-08	45.2	von Willebrand factor type A domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384917

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261405	0.663	Von Willebrand factor
2	9606.ENSP00000389414	0.659	Thromboxane-A synthase
3	9606.ENSP00000224807	0.642	Sideroflexin-3
4	9606.ENSP00000363232	0.630	Kinesin-like protein KIF12
5	9606.ENSP00000367623	0.625	Heat shock 70 kDa protein 14
6	9606.ENSP00000264741	0.622	Integrin alpha-9
7	9606.ENSP00000310335	0.596	Rab15 effector protein
8	9606.ENSP00000316905	0.593	Sideroflexin-1
9	9606.ENSP00000317123	0.579	U5 small nuclear ribonucleoprotein 200 kDa helicase
10	9606.ENSP00000272433	0.560	Sideroflexin-5
11	9606.ENSP00000258991	0.559	Testis-expressed protein 2
12	9606.ENSP00000358909	0.559	Sideroflexin-2
13	9606.ENSP00000301455	0.538	Angiopoietin-related protein 4
14	9606.ENSP00000276659	0.512	R-spondin-2
15	9606.ENSP00000238379	0.509	Haloacid dehalogenase like hydrolase domain containing 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	0.990	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.942	cellular process
GO:0065007	0.922	biological regulation
GO:0032502	0.789	developmental process
GO:0050789	0.778	regulation of biological process
GO:0048856	0.754	anatomical structure development
GO:0032501	0.753	multicellular organismal process
GO:0048731	0.738	system development
GO:0008544	0.691	epidermis development
GO:0072359	0.690	circulatory system development
GO:0001945	0.649	lymph vessel development
GO:0036303	0.609	lymph vessel morphogenesis
GO:0050794	0.599	regulation of cellular process
GO:0034330	0.587	cell junction organization
GO:0007154	0.471	cell communication
GO:0050896	0.459	response to stimulus
GO:0071704	0.326	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0043229	0.971	intracellular organelle
GO:0071944	0.929	cell periphery
GO:0043227	0.929	membrane-bounded organelle
GO:0005737	0.919	cytoplasm
GO:0043231	0.870	intracellular membrane-bounded organelle
GO:0005634	0.801	nucleus
GO:0016020	0.591	membrane
GO:0005576	0.586	extracellular region
GO:0005615	0.333	extracellular space
GO:0005886	0.328	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]