StarFunc result for job id Q4LE39

User Input

>input (1312 residues)
MKALDEPPYLTVGTDVSAKYRGAFCEAKIKTAKRLVKVKVTFRHDSSTVEVQDDHIKGPL
KVGAIVEVKNLDGAYQEAVINKLTDASWYTVVFDDGDEKTLRRSSLCLKGERHFAESETL
DQLPLTNPEHFGTPVIGKKTNRGRRSNHIPEEESSSSSSDEDEDDRKQIDELLGKVVCVD
YISLDKKKALWFPALVVCPDCSDEIAVKKDNILVRSFKDGKFTSVPRKDVHEITSDTAPK
PDAVLKQAFEQALEFHKSRTIPANWKTELKEDSSSSEAEEEEEEEDDEKEKEDNSSEEEE
EIEPFPEERENFLQQLYKFMEDRGTPINKRPVLGYRNLNLFKLFRLVHKLGGFDNIESGA
VWKQVYQDLGIPVLNSAAGYNVKCAYKKYLYGFEEYCRSANIEFQMALPEKVVNKQCKEC
ENVKEIKVKEENETEIKEIKMEEERNIIPREEKPIEDEIERKENIKPSLGSKKNLLESIP
THSDQEKEVNIKKPEDNENLDDKDDDTTRVDESLNIKVEAEEEKAKSGDETNKEEDEDDE
EAEEEEEEEEEEEDEDDDDNNEEEEFECYPPGMKVQVRYGRGKNQKMYEASIKDSDVEGG
EVLYLVHYCGWNVRYDEWIKADKIVRPADKNVPKIKHRKKIKNKLDKEKDKDEKYSPKNC
KLRRLSKPPFQTNPSPEMVSKLDLTDAKNSDTAHIKSIEITSILNGLQASESSAEDSEQE
DERGAQDMDNNGKEESKIDHLTNNRNDLISKEEQNSSSLLEENKVHADLVISKPVSKSPE
RLRKDIEVLSEDTDYEEDEVTKKRKDVKKDTTDKSSKPQIKRGKRRYCNTEECLKTGSPG
KKEEKAKNKESLCMENSSNSSSDEDEEETKAKMTPTKKYNGLEEKRKSLRTTGFYSGFSE
VAEKRIKLLNNSDERLQNSRAKDRKDVWSSIQGQWPKKTLKELFSDSDTEAAASPPHPAP
EEGVAEESLQTVAEEESCSPSVELEKPPPVNVDSKPIEEKTVEVNDRKAEFPSSGSNSVL
NTPPTTPESPSSVTVTEGSRQQSSVTVSEPLAPNQEEVRSIKSETDSTIEVDSVAGELQD
LQSEGNSSPAGFDASVSSSSSNQPEPEHPEKACTGQKRVKDAQGGGSSSKKQKRSHKATV
VNNKKKGKGTNSSDSEELSAGESITKSQPVKSVSTGMKSHSTKSPARTQSPGKCGKNGDK
DPDLKEPSNRLPKVYKWSFQMSDLENMTSAERITILQEKLQEIRKHYLSLKSEVASIDRR
RKRLKKKERESAATSSSSSSPSSSSITAAVMLTLAEPSMSSASQNGMSVECR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2CG63	0.295	0.295	0.000	1314	0.897	0.896	A2CG63.pdb.gz	ARI4B_MOUSE AT-rich interactive domain-containing protein 4B OS=Mus musculus OX=10090 GN=Arid4b PE=1 SV=1
2	AFDB:Q4LE39	0.999	0.999	0.000	1312	1.000	1.000	Q4LE39.pdb.gz	ARI4B_HUMAN AT-rich interactive domain-containing protein 4B OS=Homo sapiens OX=9606 GN=ARID4B PE=1 SV=2
3	AFDB:A0A024R657	0.186	0.194	2.668E-80	1257	0.434	0.453	A0A024R657.pdb.gz
4	AFDB:F8VPQ2	0.293	0.304	7.384E-78	1261	0.418	0.435	F8VPQ2.pdb.gz	ARI4A_MOUSE AT-rich interactive domain-containing protein 4A OS=Mus musculus OX=10090 GN=Arid4a PE=1 SV=1
5	AFDB:Q9VWP5	0.112	0.074	1.255E-40	2486	0.252	0.133	Q9VWP5.pdb.gz	Q9VWP5_DROME Hat-trick, isoform D OS=Drosophila melanogaster OX=7227 GN=htk PE=1 SV=4
6	AFDB:Q8BM75	0.076	0.083	2.591E-5	1188	0.113	0.125	Q8BM75.pdb.gz	ARI5B_MOUSE AT-rich interactive domain-containing protein 5B OS=Mus musculus OX=10090 GN=Arid5b PE=1 SV=3
7	PDB:6hiwDB	0.045	0.050	3.584E-5	1111	0.027	0.032	6hiwDB.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
8	AFDB:Q14865	0.076	0.084	5.924E-5	1188	0.127	0.141	Q14865.pdb.gz	ARI5B_HUMAN AT-rich interactive domain-containing protein 5B OS=Homo sapiens OX=9606 GN=ARID5B PE=1 SV=3
9	AFDB:Q1LYG0	0.066	0.072	2.624E-4	1119	0.110	0.129	Q1LYG0.pdb.gz	SPD2A_DANRE SH3 and PX domain-containing protein 2A OS=Danio rerio OX=7955 GN=sh3pxd2a PE=3 SV=2
10	PDB:2ns2A	0.048	0.269	1.819E-2	201	0.020	0.129	2ns2A.pdb.gz	Structure of human spindlin1. Tandem tudor-like domains for cell cycle regulation
11	PDB:2lqnA	0.034	0.119	2.031E-2	303	0.014	0.063	2lqnA.pdb.gz
12	PDB:6tedZ	0.036	0.084	2.146E-2	510	0.023	0.059	6tedZ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
13	AFDB:F4JV48	0.059	0.072	5.514E-2	995	0.096	0.127	F4JV48.pdb.gz	F4JV48_ARATH Homeodomain-like protein OS=Arabidopsis thaliana OX=3702 GN=PC-MYB1 PE=1 SV=1
14	AFDB:Q15652	0.048	0.029	6.156E-2	2540	0.136	0.070	Q15652.pdb.gz	JHD2C_HUMAN Probable JmjC domain-containing histone demethylation protein 2C OS=Homo sapiens OX=9606 GN=JMJD1C PE=1 SV=2
15	PDB:3n6rA	0.032	0.060	7.628E-2	591	0.021	0.046	3n6rA.pdb.gz	Crystal structure of the alpha(6)beta(6) holoenzyme of propionyl-coenzyme A carboxylase.
16	PDB:3n6rG	0.032	0.056	1.005E-1	646	0.021	0.042	3n6rG.pdb.gz	Crystal structure of the alpha(6)beta(6) holoenzyme of propionyl-coenzyme A carboxylase.
17	PDB:7okyZ	0.038	0.119	1.005E-1	374	0.030	0.104	7okyZ.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
18	PDB:7m8eF	0.025	0.032	1.253E-1	967	0.009	0.012	7m8eF.pdb.gz	Structural basis for activation of Swi2/Snf2 ATPase RapA by RNA polymerase.
19	PDB:7un3A	0.030	0.049	1.843E-1	649	0.018	0.037	7un3A.pdb.gz
20	PDB:1zq1A	0.032	0.081	3.027E-1	437	0.011	0.034	1zq1A.pdb.gz	Structural Basis for tRNA-Dependent Amidotransferase Function

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2CG63	0.0	2048	1314	0.879	0.877	ARI4B_MOUSE AT-rich interactive domain-containing protein 4B OS=Mus musculus OX=10090 GN=Arid4b PE=1 SV=1
2	H0Y7Y8	0.0	1083	553	0.418	0.991	H0Y7Y8_HUMAN AT-rich interaction domain 4B (Fragment) OS=Homo sapiens OX=9606 GN=ARID4B PE=1 SV=2
3	Q4LE39	0.0	2661	1312	1.000	1.000	ARI4B_HUMAN AT-rich interactive domain-containing protein 4B OS=Homo sapiens OX=9606 GN=ARID4B PE=1 SV=2
4	P29374	4.23e-163	523	1257	0.213	0.223	ARI4A_HUMAN AT-rich interactive domain-containing protein 4A OS=Homo sapiens OX=9606 GN=ARID4A PE=1 SV=3
5	F8VPQ2	7.52e-159	512	1261	0.212	0.220	ARI4A_MOUSE AT-rich interactive domain-containing protein 4A OS=Mus musculus OX=10090 GN=Arid4a PE=1 SV=1
6	Q9VWP5	5.83e-89	321	2486	0.138	0.073	Q9VWP5_DROME Hat-trick, isoform D OS=Drosophila melanogaster OX=7227 GN=htk PE=1 SV=4
7	Q9Z1N7	2.99e-15	82.8	568	0.027	0.063	ARI3B_MOUSE AT-rich interactive domain-containing protein 3B OS=Mus musculus OX=10090 GN=Arid3b PE=1 SV=1
8	Q8IVW6	4.37e-15	82.4	561	0.027	0.064	ARI3B_HUMAN AT-rich interactive domain-containing protein 3B OS=Homo sapiens OX=9606 GN=ARID3B PE=1 SV=2
9	Q62431	6.89e-14	78.6	601	0.023	0.050	ARI3A_MOUSE AT-rich interactive domain-containing protein 3A OS=Mus musculus OX=10090 GN=Arid3a PE=1 SV=1
10	Q24573	1.35e-13	78.2	911	0.027	0.038	DRI_DROME Protein dead ringer OS=Drosophila melanogaster OX=7227 GN=retn PE=1 SV=2
11	Q99856	1.58e-13	77.4	593	0.023	0.051	ARI3A_HUMAN AT-rich interactive domain-containing protein 3A OS=Homo sapiens OX=9606 GN=ARID3A PE=1 SV=2
12	Q14865	3.04e-13	77.4	1188	0.040	0.044	ARI5B_HUMAN AT-rich interactive domain-containing protein 5B OS=Homo sapiens OX=9606 GN=ARID5B PE=1 SV=3
13	A6NKF2	3.46e-13	75.5	412	0.030	0.097	ARI3C_HUMAN AT-rich interactive domain-containing protein 3C OS=Homo sapiens OX=9606 GN=ARID3C PE=1 SV=1
14	Q3U108	3.56e-13	76.3	590	0.037	0.081	ARI5A_MOUSE AT-rich interactive domain-containing protein 5A OS=Mus musculus OX=10090 GN=Arid5a PE=1 SV=1
15	B7ZP08	1.49e-12	73.2	379	0.029	0.100	B7ZP08_MOUSE AT-rich interactive domain-containing protein 3 OS=Mus musculus OX=10090 GN=Arid3c PE=2 SV=1
16	A6PWV5	1.50e-12	73.6	409	0.029	0.093	ARI3C_MOUSE AT-rich interactive domain-containing protein 3C OS=Mus musculus OX=10090 GN=Arid3c PE=2 SV=2
17	Q8BM75	4.88e-12	73.2	1188	0.022	0.024	ARI5B_MOUSE AT-rich interactive domain-containing protein 5B OS=Mus musculus OX=10090 GN=Arid5b PE=1 SV=3
18	A0A669KBH0	1.73e-11	69.3	327	0.021	0.083	A0A669KBH0_HUMAN AT-rich interaction domain 5A OS=Homo sapiens OX=9606 GN=ARID5A PE=1 SV=1
19	Q03989	7.61e-11	68.9	594	0.021	0.045	ARI5A_HUMAN AT-rich interactive domain-containing protein 5A OS=Homo sapiens OX=9606 GN=ARID5A PE=1 SV=2
20	O02326	6.65e-10	65.5	467	0.020	0.056	CFI1_CAEEL AT-rich interactive domain-containing protein cfi-1 OS=Caenorhabditis elegans OX=6239 GN=cfi-1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01388 ARID	1.8e-16	71.9	ARID/BRIGHT DNA binding domain
2	PF18914 DUF5666	2.9e+02	13.2	Domain of unknown function (DUF5666)
3	PF08169 RBB1NT	1.7e-32	122.7	RBB1NT (NUC162) domain
4	PF11717 Tudor-knot	0.00041	31.5	RNA binding activity-knot of a chromodomain
5	PF18104 Tudor_2	1.4	20.0	Jumonji domain-containing protein 2A Tudor domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264183

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378402	0.995	Paired amphipathic helix protein Sin3a
2	9606.ENSP00000296504	0.981	Histone deacetylase complex subunit SAP30
3	9606.ENSP00000443988	0.978	Sin3 histone deacetylase corepressor complex component SDS3
4	9606.ENSP00000362649	0.963	Histone deacetylase 1
5	9606.ENSP00000369131	0.959	Paired amphipathic helix protein Sin3b
6	9606.ENSP00000350333	0.957	Histone deacetylase complex subunit SAP130
7	9606.ENSP00000430432	0.949	Histone deacetylase 2
8	9606.ENSP00000296417	0.941	Histone H2A.Z
9	9606.ENSP00000308405	0.941	Histone H2A.V
10	9606.ENSP00000369424	0.937	Histone-binding protein RBBP7
11	9606.ENSP00000434024	0.935	Histone H2AX
12	9606.ENSP00000362592	0.934	Histone-binding protein RBBP4
13	9606.ENSP00000297012	0.915	Histone H2A type 1-A
14	9606.ENSP00000328484	0.915	Histone H2A type 1-J
15	9606.ENSP00000332194	0.915	Histone H2A type 2-C
16	9606.ENSP00000332790	0.915	Histone H2A type 2-B
17	9606.ENSP00000341094	0.915	Histone H2A type 1-D
18	9606.ENSP00000355656	0.915	Histone H2A type 3
19	9606.ENSP00000358151	0.915	Histone H2B type 2-E
20	9606.ENSP00000366679	0.915	Histone H2A type 1-H

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.628	nucleic acid binding
GO:0003677	0.542	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0060255	0.990	regulation of macromolecule metabolic process
GO:0044238	0.989	primary metabolic process
GO:0080090	0.989	regulation of primary metabolic process
GO:0051171	0.989	regulation of nitrogen compound metabolic process
GO:0043170	0.985	macromolecule metabolic process
GO:0031323	0.985	regulation of cellular metabolic process
GO:0006807	0.984	nitrogen compound metabolic process
GO:0010468	0.980	regulation of gene expression
GO:0019219	0.969	regulation of nucleobase-containing compound metabolic process
GO:0043412	0.965	macromolecule modification
GO:0044237	0.964	cellular metabolic process
GO:0016570	0.960	histone modification
GO:0048518	0.957	positive regulation of biological process
GO:0006325	0.954	chromatin organization
GO:0048522	0.946	positive regulation of cellular process
GO:0032501	0.940	multicellular organismal process
GO:0045893	0.940	positive regulation of DNA-templated transcription
GO:0048856	0.937	anatomical structure development
GO:0018205	0.924	peptidyl-lysine modification
GO:0006357	0.918	regulation of transcription by RNA polymerase II
GO:0048731	0.896	system development
GO:0061458	0.884	reproductive system development
GO:0090304	0.876	nucleic acid metabolic process
GO:0018022	0.876	peptidyl-lysine methylation
GO:0016571	0.875	histone methylation
GO:0045137	0.785	development of primary sexual characteristics
GO:0044249	0.780	cellular biosynthetic process
GO:0048519	0.640	negative regulation of biological process
GO:0009892	0.517	negative regulation of metabolic process
GO:0045944	0.509	positive regulation of transcription by RNA polymerase II
GO:0048523	0.464	negative regulation of cellular process
GO:0016070	0.433	RNA metabolic process
GO:0048513	0.431	animal organ development
GO:0010605	0.424	negative regulation of macromolecule metabolic process
GO:0031324	0.419	negative regulation of cellular metabolic process
GO:0010467	0.414	gene expression
GO:0019438	0.412	aromatic compound biosynthetic process
GO:0051172	0.407	negative regulation of nitrogen compound metabolic process
GO:0008406	0.393	gonad development
GO:0046546	0.387	development of primary male sexual characteristics
GO:0034968	0.379	histone lysine methylation
GO:0006338	0.344	chromatin remodeling
GO:0019953	0.340	sexual reproduction
GO:0009059	0.340	macromolecule biosynthetic process
GO:0048609	0.337	multicellular organismal reproductive process
GO:0030154	0.336	cell differentiation
GO:0008584	0.334	male gonad development
GO:0006351	0.334	DNA-templated transcription
GO:0007276	0.312	gamete generation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0005739	0.987	mitochondrion
GO:0043232	0.749	intracellular non-membrane-bounded organelle
GO:0032991	0.573	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]