StarFunc result for job id Q4V9L6

User Input

>input (283 residues)
MVSAAAPSLLILLLLLLGSVPATDARSVPLKATFLEDVAGSGEAEGSSASSPSLPPPWTP
ALSPTSMGPQPITLGGPSPPTNFLDGIVDFFRQYVMLIAVVGSLAFLLMFIVCAAVITRQ
KQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALDSSRQLQADILAAT
QNLKSPTRAALGGGDGARMVEGRGAEEEEKGSQEGDQEVQGHGVPVETPEAQEEPCSGVL
EGAVVAGEGQGELEGSLLLAQEAQGPVGPPESPCACSSVHPSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4V9L6	0.999	0.999	1.016E-41	283	1.000	1.000	Q4V9L6.pdb.gz	TM119_HUMAN Transmembrane protein 119 OS=Homo sapiens OX=9606 GN=TMEM119 PE=1 SV=1
2	AFDB:Q8R138	0.505	0.509	5.435E-27	280	0.668	0.675	Q8R138.pdb.gz	TM119_MOUSE Transmembrane protein 119 OS=Mus musculus OX=10090 GN=Tmem119 PE=1 SV=1
3	AFDB:Q6ZMI3	0.145	0.086	7.902E-3	551	0.166	0.085	Q6ZMI3.pdb.gz	GLDN_HUMAN Gliomedin OS=Homo sapiens OX=9606 GN=GLDN PE=1 SV=1
4	AFDB:A0A1D5NS60	0.148	0.092	1.915E-2	528	0.131	0.070	A0A1D5NS60.pdb.gz	ZN16L_DANRE Zinc finger protein 16-like OS=Danio rerio OX=7955 GN=znf16l PE=1 SV=1
5	AFDB:Q389J7	0.104	0.097	6.524E-2	306	0.138	0.127	Q389J7.pdb.gz	Q389J7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0520 PE=4 SV=1
6	AFDB:A0A096MK70	0.122	0.119	8.003E-2	291	0.141	0.137	A0A096MK70.pdb.gz	A0A096MK70_RAT Aspartate-beta-hydroxylase OS=Rattus norvegicus OX=10116 GN=Asph PE=1 SV=2
7	AFDB:Q8BHX3	0.155	0.152	8.567E-2	289	0.124	0.121	Q8BHX3.pdb.gz	BOREA_MOUSE Borealin OS=Mus musculus OX=10090 GN=Cdca8 PE=1 SV=2
8	AFDB:Q9UKD1	0.134	0.084	9.171E-2	530	0.177	0.094	Q9UKD1.pdb.gz	GMEB2_HUMAN Glucocorticoid modulatory element-binding protein 2 OS=Homo sapiens OX=9606 GN=GMEB2 PE=1 SV=1
9	AFDB:Q28264	0.112	0.144	9.817E-2	210	0.110	0.148	Q28264.pdb.gz	Q28264_CANLF Junctional sarcoplasmic reticulum protein OS=Canis lupus familiaris OX=9615 PE=2 SV=1
10	AFDB:Q9NQX5	0.136	0.121	1.125E-1	325	0.117	0.102	Q9NQX5.pdb.gz	NPDC1_HUMAN Neural proliferation differentiation and control protein 1 OS=Homo sapiens OX=9606 GN=NPDC1 PE=1 SV=2
11	PDB:6zdbA	0.116	0.207	4.265	129	0.078	0.171	6zdbA.pdb.gz
12	PDB:6nmiC	0.112	0.084	4.888	408	0.092	0.064	6nmiC.pdb.gz	The complete structure of the human TFIIH core complex.
13	PDB:7b93p	0.068	0.108	7.354	171	0.081	0.135	7b93p.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
14	PDB:7egb1	0.111	0.083	7.873	405	0.071	0.049	7egb1.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
15	PDB:6t9iK	0.086	0.087	8.427	279	0.049	0.050	6t9iK.pdb.gz
16	PDB:6gmhU	0.083	0.183	9.657	110	0.014	0.036	6gmhU.pdb.gz	Structure of activated transcription complex Pol II-DSIF-PAF-SPT6.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q4V9L6	0.0	558	283	1.000	1.000	TM119_HUMAN Transmembrane protein 119 OS=Homo sapiens OX=9606 GN=TMEM119 PE=1 SV=1
2	Q8R138	5.37e-103	303	280	0.650	0.657	TM119_MOUSE Transmembrane protein 119 OS=Mus musculus OX=10090 GN=Tmem119 PE=1 SV=1
3	Q8JH78	0.52	34.3	1186	0.124	0.030	Q8JH78_DANRE Erg K+ channel OS=Danio rerio OX=7955 GN=erg PE=2 SV=1
4	P08843	0.60	33.9	350	0.092	0.074	ADH1_EMENI Alcohol dehydrogenase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=alcA PE=3 SV=2
5	P23470	3.9	31.6	1445	0.099	0.019	PTPRG_HUMAN Receptor-type tyrosine-protein phosphatase gamma OS=Homo sapiens OX=9606 GN=PTPRG PE=1 SV=4
6	P70407	6.6	30.8	786	0.074	0.027	CADH9_MOUSE Cadherin-9 OS=Mus musculus OX=10090 GN=Cdh9 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13179 DUF4006	4.8e+02	12.1	Family of unknown function (DUF4006)
2	PF15726 DUF4677	36	16.0	Domain of unknown function (DUF4677)
3	PF16101 PRIMA1	13	17.2	Proline-rich membrane anchor 1
4	PF15724 TMEM119	2e-146	498.4	TMEM119 family
5	PF15102 TMEM154	8.8e+02	11.1	TMEM154 protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376553

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307259	0.824	P2Y purinoceptor 12
2	9606.ENSP00000322273	0.749	Olfactomedin-like protein 3
3	9606.ENSP00000362205	0.719	Triggering receptor expressed on myeloid cells 2
4	9606.ENSP00000351059	0.717	CX3C chemokine receptor 1
5	9606.ENSP00000367384	0.703	Probable G-protein coupled receptor 34
6	9606.ENSP00000365227	0.687	Allograft inflammatory factor 1
7	9606.ENSP00000251020	0.677	Sal-like protein 1
8	9606.ENSP00000340975	0.596	Ankyrin repeat domain-containing protein SOWAHD
9	9606.ENSP00000320376	0.583	P2Y purinoceptor 13
10	9606.ENSP00000286301	0.582	Macrophage colony-stimulating factor 1 receptor
11	9606.ENSP00000325895	0.574	Ankyrin repeat and death domain containing 1A
12	9606.ENSP00000358902	0.566	Sterile alpha motif domain containing 10
13	9606.ENSP00000397863	0.562	Interleukin-34
14	9606.ENSP00000353942	0.559	Dynein regulatory complex subunit 7
15	9606.ENSP00000439601	0.556	Rho GTPase-activating protein 45
16	9606.ENSP00000362107	0.554	Four and a half LIM domains 3
17	9606.ENSP00000355157	0.552	Fc receptor-like protein 2
18	9606.ENSP00000432305	0.538	Sperm surface protein Sp17
19	9606.ENSP00000441691	0.525	Integrin alpha-M
20	9606.ENSP00000295408	0.513	Tyrosine-protein kinase Mer

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0048518	0.983	positive regulation of biological process
GO:0048522	0.964	positive regulation of cellular process
GO:0051240	0.906	positive regulation of multicellular organismal process
GO:0042127	0.892	regulation of cell population proliferation
GO:0008284	0.837	positive regulation of cell population proliferation
GO:0050793	0.817	regulation of developmental process
GO:0009987	0.812	cellular process
GO:0045597	0.805	positive regulation of cell differentiation
GO:2000026	0.795	regulation of multicellular organismal development
GO:0070167	0.755	regulation of biomineral tissue development
GO:0030278	0.746	regulation of ossification
GO:0045667	0.717	regulation of osteoblast differentiation
GO:0030500	0.715	regulation of bone mineralization
GO:0019222	0.623	regulation of metabolic process
GO:0030501	0.577	positive regulation of bone mineralization
GO:0045669	0.569	positive regulation of osteoblast differentiation
GO:0032501	0.562	multicellular organismal process
GO:0009893	0.482	positive regulation of metabolic process
GO:0032502	0.463	developmental process
GO:0048856	0.449	anatomical structure development
GO:0050896	0.412	response to stimulus
GO:0060255	0.405	regulation of macromolecule metabolic process
GO:0080090	0.394	regulation of primary metabolic process
GO:0010604	0.378	positive regulation of macromolecule metabolic process
GO:0010468	0.376	regulation of gene expression
GO:0051171	0.373	regulation of nitrogen compound metabolic process
GO:0048519	0.370	negative regulation of biological process
GO:0051246	0.353	regulation of protein metabolic process
GO:0031323	0.346	regulation of cellular metabolic process
GO:0048523	0.336	negative regulation of cellular process
GO:0031325	0.334	positive regulation of cellular metabolic process
GO:0051173	0.328	positive regulation of nitrogen compound metabolic process
GO:0048583	0.321	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.961	intracellular anatomical structure
GO:0043226	0.934	organelle
GO:0005737	0.927	cytoplasm
GO:0043227	0.913	membrane-bounded organelle
GO:0043231	0.866	intracellular membrane-bounded organelle
GO:0012505	0.658	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]