StarFunc result for job id Q4VC05

User Input

>input (210 residues)
MSGRSVRAETRSRAKDDIKRVMAAIEKVRKWEKKWVTVGDTSLRIYKWVPVTEPKVDDKN
KNKKKGKDEKCGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPN
SAVPSDGTEAKVDEAQADGKEHPGAEDASDEQNSQSSMEHSMNSSEKVDRQPSGDSGLAA
ETSAISQDLEGVPPSKKMKLEASQQNSEEM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4VC05	0.999	0.999	5.744E-28	210	1.000	1.000	Q4VC05.pdb.gz	BCL7A_HUMAN B-cell CLL/lymphoma 7 protein family member A OS=Homo sapiens OX=9606 GN=BCL7A PE=1 SV=1
2	AFDB:Q921K9	0.322	0.333	4.103E-10	202	0.414	0.431	Q921K9.pdb.gz	BCL7B_MOUSE B-cell CLL/lymphoma 7 protein family member B OS=Mus musculus OX=10090 GN=Bcl7b PE=1 SV=1
3	AFDB:O08664	0.324	0.315	9.386E-9	217	0.386	0.373	O08664.pdb.gz	BCL7C_MOUSE B-cell CLL/lymphoma 7 protein family member C OS=Mus musculus OX=10090 GN=Bcl7c PE=1 SV=1
4	AFDB:Q0E9G3	0.127	0.040	1.256	834	0.138	0.035	Q0E9G3.pdb.gz	KTU_DROME Protein kintoun OS=Drosophila melanogaster OX=7227 GN=Nop17l PE=1 SV=1
5	AFDB:Q54NF8	0.145	0.086	1.906	443	0.148	0.070	Q54NF8.pdb.gz	SCAR_DICDI Protein SCAR OS=Dictyostelium discoideum OX=44689 GN=scrA PE=1 SV=1
6	AFDB:Q384A0	0.129	0.045	2.348	763	0.138	0.038	Q384A0.pdb.gz	Q384A0_TRYB2 Protein kinase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1050 PE=4 SV=1
7	PDB:2zdiC	0.104	0.142	3.986	148	0.033	0.047	2zdiC.pdb.gz
8	PDB:2zdiB	0.109	0.202	4.911	106	0.033	0.066	2zdiB.pdb.gz
9	AFDB:Q20398	0.098	0.031	5.047	1084	0.138	0.027	Q20398.pdb.gz	Q20398_CAEEL PDZ domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=magu-4 PE=1 SV=2
10	AFDB:Q6FVC8	0.127	0.062	5.411	498	0.100	0.042	Q6FVC8.pdb.gz	Q6FVC8_CANGA Candida glabrata strain CBS138 chromosome E complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0E02915g PE=4 SV=1
11	PDB:2efcB	0.069	0.083	5.644	165	0.014	0.018	2efcB.pdb.gz	GDP-bound and nucleotide-free intermediates of the guanine nucleotide exchange in the Rab5/Vps9 system
12	PDB:3zqqC	0.112	0.168	5.644	134	0.048	0.075	3zqqC.pdb.gz
13	PDB:7pd3z	0.100	0.069	5.644	311	0.029	0.019	7pd3z.pdb.gz	Visualizing formation of the active site in the mitochondrial ribosome.
14	AFDB:Q6NWW9	0.107	0.025	5.801	1207	0.129	0.022	Q6NWW9.pdb.gz	FND3B_MOUSE Fibronectin type III domain-containing protein 3B OS=Mus musculus OX=10090 GN=Fndc3b PE=1 SV=1
15	AFDB:Q9Y091	0.110	0.046	5.801	536	0.162	0.063	Q9Y091.pdb.gz	FL2D_DROME Pre-mRNA-splicing regulator female-lethal(2)D OS=Drosophila melanogaster OX=7227 GN=fl(2)d PE=1 SV=2
16	PDB:3j9zSG	0.098	0.111	6.051	178	0.062	0.073	3j9zSG.pdb.gz	Activation of GTP hydrolysis in mRNA-tRNA translocation by elongation factor G.
17	PDB:5w5fA	0.066	0.081	6.051	163	0.014	0.018	5w5fA.pdb.gz
18	PDB:6hivCn	0.095	0.168	6.051	110	0.038	0.073	6hivCn.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
19	PDB:1st0A	0.077	0.058	7.455	300	0.024	0.017	1st0A.pdb.gz	Insights into the structure, mechanism, and regulation of scavenger mRNA decapping activity
20	PDB:4m4wO	0.074	0.065	7.455	250	0.029	0.024	4m4wO.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q4VC05	1.77e-151	420	210	1.000	1.000	BCL7A_HUMAN B-cell CLL/lymphoma 7 protein family member A OS=Homo sapiens OX=9606 GN=BCL7A PE=1 SV=1
2	Q9CXE2	3.99e-128	361	210	0.943	0.943	BCL7A_MOUSE B-cell CLL/lymphoma 7 protein family member A OS=Mus musculus OX=10090 GN=Bcl7a PE=2 SV=1
3	Q9BQE9	5.81e-39	134	202	0.329	0.342	BCL7B_HUMAN B-cell CLL/lymphoma 7 protein family member B OS=Homo sapiens OX=9606 GN=BCL7B PE=1 SV=1
4	Q921K9	1.10e-38	134	202	0.329	0.342	BCL7B_MOUSE B-cell CLL/lymphoma 7 protein family member B OS=Mus musculus OX=10090 GN=Bcl7b PE=1 SV=1
5	O08664	2.40e-32	118	217	0.286	0.276	BCL7C_MOUSE B-cell CLL/lymphoma 7 protein family member C OS=Mus musculus OX=10090 GN=Bcl7c PE=1 SV=1
6	Q8WUZ0	4.46e-32	117	217	0.295	0.286	BCL7C_HUMAN B-cell CLL/lymphoma 7 protein family member C OS=Homo sapiens OX=9606 GN=BCL7C PE=1 SV=3
7	A0A0A0MTC1	0.081	36.2	5256	0.152	0.006	A0A0A0MTC1_HUMAN Ring finger protein 213 OS=Homo sapiens OX=9606 GN=RNF213 PE=1 SV=1
8	Q63HN8	0.081	36.2	5207	0.152	0.006	RN213_HUMAN E3 ubiquitin-protein ligase RNF213 OS=Homo sapiens OX=9606 GN=RNF213 PE=1 SV=3
9	A0A0A0MTR7	0.084	36.2	5207	0.152	0.006	A0A0A0MTR7_HUMAN Ring finger protein 213 OS=Homo sapiens OX=9606 GN=RNF213 PE=1 SV=1
10	Q6TEL0	0.96	32.7	632	0.124	0.041	MTMR8_DANRE Myotubularin-related protein 8 OS=Danio rerio OX=7955 GN=mtmr8 PE=2 SV=1
11	O95255	1.3	32.3	1503	0.133	0.019	MRP6_HUMAN ATP-binding cassette sub-family C member 6 OS=Homo sapiens OX=9606 GN=ABCC6 PE=1 SV=2
12	Q9P377	2.4	31.6	1826	0.143	0.016	FKS3_SCHPO 1,3-beta-glucan synthase component bgs3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgs3 PE=1 SV=1
13	Q9FLP2	2.5	30.8	168	0.048	0.060	Q9FLP2_ARATH At5g55210 OS=Arabidopsis thaliana OX=3702 GN=MCO15.16 PE=1 SV=1
14	P41895	3.9	30.8	735	0.119	0.034	T2FA_YEAST Transcription initiation factor IIF subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TFG1 PE=1 SV=2
15	F8W3Z0	6.5	30.4	2280	0.148	0.014	F8W3Z0_DANRE Calcium channel, voltage-dependent, P/Q type, alpha 1A subunit, b OS=Danio rerio OX=7955 GN=CACNA1Ab PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04714 BCL_N	3e-25	99.4	BCL7, N-terminal conserver region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000015873

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000004023	0.883	D4, zinc and double PHD fingers family 2
2	60711.ENSCSAP00000003179	0.879	Uncharacterized protein
3	60711.ENSCSAP00000009037	0.865	D4, zinc and double PHD fingers, family 3
4	60711.ENSCSAP00000013829	0.863	SS18, nBAF chromatin remodeling complex subunit
5	60711.ENSCSAP00000002292	0.860	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1
6	60711.ENSCSAP00000017030	0.859	AT rich interactive domain 1A (SWI-like)
7	60711.ENSCSAP00000004907	0.858	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2
8	60711.ENSCSAP00000007490	0.853	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
9	60711.ENSCSAP00000009399	0.848	AT rich interactive domain 1B (SWI1-like)
10	60711.ENSCSAP00000012054	0.781	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1
11	60711.ENSCSAP00000015003	0.771	dCMP deaminase
12	60711.ENSCSAP00000001525	0.742	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2
13	60711.ENSCSAP00000015105	0.731	BRD4 interacting chromatin remodeling complex associated protein
14	60711.ENSCSAP00000015243	0.729	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1
15	60711.ENSCSAP00000000291	0.728	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
16	60711.ENSCSAP00000002917	0.719	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
17	60711.ENSCSAP00000011848	0.713	SS18L1, nBAF chromatin remodeling complex subunit
18	60711.ENSCSAP00000013448	0.679	Bromodomain containing 9
19	60711.ENSCSAP00000010294	0.678	MYB proto-oncogene like 1
20	60711.ENSCSAP00000007669	0.655	BRD4 interacting chromatin remodeling complex associated protein like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.988	anatomical structure development
GO:0009987	0.966	cellular process
GO:0007275	0.961	multicellular organism development
GO:0065007	0.915	biological regulation
GO:0050789	0.905	regulation of biological process
GO:0050794	0.879	regulation of cellular process
GO:0048731	0.817	system development
GO:0048513	0.403	animal organ development
GO:0071840	0.400	cellular component organization or biogenesis
GO:0016043	0.356	cellular component organization
GO:0009790	0.345	embryo development
GO:0009653	0.335	anatomical structure morphogenesis
GO:0019222	0.321	regulation of metabolic process
GO:0007389	0.307	pattern specification process
GO:0048519	0.306	negative regulation of biological process
GO:0060255	0.303	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016514	1.000	SWI/SNF complex
GO:0031981	0.536	nuclear lumen
GO:0005654	0.466	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]