StarFunc result for job id Q4VC44

User Input

>input (716 residues)
MPLPEPSEQEGESVKAGQEPSPKPGTDVIPAAPRKPREFSKLVLLTASDQDEDGVGSKPQ
EVHCVLSLEMAGPATLASTLQILPVEEQGGVVQPALEMPEQKCSKLDAAAPQSLEFLRTP
FGGRLLVLESFLYKQEKAVGDKVYWKCRQHAELGCRGRAITRGLRATVMRGHCHAPDEQG
LEARRQREKLPSLALPEGLGEPQGPEGPGGRVEEPLEGVGPWQCPEEPEPTPGLVLSKPA
LEEEEAPRALSLLSLPPKKRSILGLGQARPLEFLRTCYGGSFLVHESFLYKREKAVGDKV
YWTCRDHALHGCRSRAITQGQRVTVMRGHCHQPDMEGLEARRQQEKAVETLQAGQDGPGS
QVDTLLRGVDSLLYRRGPGPLTLTRPRPRKRAKVEDQELPTQPEAPDEHQDMDADPGGPE
FLKTPLGGSFLVYESFLYRREKAAGEKVYWTCRDQARMGCRSRAITQGRRVTVMRGHCHP
PDLGGLEALRQREKRPNTAQRGSPGGPEFLKTPLGGSFLVYESFLYRREKAAGEKVYWTC
RDQARMGCRSRAITQGRRVMVMRRHCHPPDLGGLEALRQREHFPNLAQWDSPDPLRPLEF
LRTSLGGRFLVHESFLYRKEKAAGEKVYWMCRDQARLGCRSRAITQGHRIMVMRSHCHQP
DLAGLEALRQRERLPTTAQQEDPEKIQVQLCFKTCSPESQQIYGDIKDVRLDGESQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4VC44	1.000	1.000	0.000	716	1.000	1.000	Q4VC44.pdb.gz	FWCH1_HUMAN FLYWCH-type zinc finger-containing protein 1 OS=Homo sapiens OX=9606 GN=FLYWCH1 PE=1 SV=2
2	AFDB:Q86B87	0.093	0.108	1.220E-4	610	0.096	0.113	Q86B87.pdb.gz	MMD4_DROME Modifier of mdg4 OS=Drosophila melanogaster OX=7227 GN=mod(mdg4) PE=1 SV=1
3	AFDB:Q9VDB7	0.066	0.047	6.289E-4	1108	0.140	0.090	Q9VDB7.pdb.gz	Q9VDB7_DROME LP06548p OS=Drosophila melanogaster OX=7227 GN=aus PE=1 SV=4
4	AFDB:F1M842	0.060	0.034	7.370E-4	1972	0.119	0.043	F1M842.pdb.gz	F1M842_RAT Tumor protein p53 binding protein 1 OS=Rattus norvegicus OX=10116 GN=Tp53bp1 PE=1 SV=3
5	AFDB:Q12888	0.061	0.032	2.766E-3	1972	0.115	0.042	Q12888.pdb.gz	TP53B_HUMAN TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2
6	AFDB:Q86BS3	0.064	0.055	3.418E-3	926	0.140	0.108	Q86BS3.pdb.gz	Q86BS3_DROME Chromator, isoform A OS=Drosophila melanogaster OX=7227 GN=Chro PE=1 SV=1
7	PDB:7nkyO	0.101	0.142	1.613E-2	427	0.057	0.096	7nkyO.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
8	AFDB:A1ZBH7	0.050	0.037	2.065E-2	1218	0.133	0.078	A1ZBH7.pdb.gz	A1ZBH7_DROME Happyhour, isoform A OS=Drosophila melanogaster OX=7227 GN=hppy PE=1 SV=1
9	PDB:5mxcA	0.065	0.116	2.216E-2	313	0.039	0.089	5mxcA.pdb.gz	Influence of Trp flipping on carbohydrate binding in lectins. An example on Aleuria aurantia lectin AAL.
10	AFDB:O14306	0.057	0.040	2.420E-2	1191	0.116	0.070	O14306.pdb.gz	YE8A_SCHPO Probable inositol polyphosphate 5-phosphatase C9G1.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC9G1.10c PE=1 SV=2
11	AFDB:A0A0U1RQE4	0.074	0.061	2.836E-2	1047	0.145	0.099	A0A0U1RQE4.pdb.gz	A0A0U1RQE4_HUMAN SH3 domain containing 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=1
12	AFDB:A0A2R6W1B1	0.062	0.072	3.695E-2	571	0.102	0.128	A0A2R6W1B1.pdb.gz	ESV1_MARPO Protein EARLY STARVATION 1, chloroplastic OS=Marchantia polymorpha OX=3197 GN=ESV1 PE=3 SV=1
13	PDB:5y31B	0.077	0.100	3.761E-2	511	0.039	0.055	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
14	PDB:6n8sA	0.052	0.047	4.408E-2	834	0.038	0.032	6n8sA.pdb.gz
15	PDB:7nvrl	0.085	0.099	6.055E-2	501	0.038	0.054	7nvrl.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
16	PDB:4noxA	0.056	0.081	7.096E-2	460	0.034	0.052	4noxA.pdb.gz
17	PDB:4fhmA	0.045	0.069	7.482E-2	354	0.021	0.042	4fhmA.pdb.gz
18	PDB:2ns2A	0.057	0.153	7.888E-2	201	0.029	0.104	2ns2A.pdb.gz	Structure of human spindlin1. Tandem tudor-like domains for cell cycle regulation
19	PDB:6id0W	0.051	0.064	7.888E-2	509	0.053	0.075	6id0W.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
20	PDB:4n8eB	0.056	0.055	8.769E-2	734	0.039	0.038	4n8eB.pdb.gz	Discovery of C-(1-aryl-cyclohexyl)-methylamines as selective, orally available inhibitors of dipeptidyl peptidase IV.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q4VC44	0.0	1445	716	1.000	1.000	FWCH1_HUMAN FLYWCH-type zinc finger-containing protein 1 OS=Homo sapiens OX=9606 GN=FLYWCH1 PE=1 SV=2
2	Q96CP2	1.09e-30	119	140	0.098	0.500	FWCH2_HUMAN FLYWCH family member 2 OS=Homo sapiens OX=9606 GN=FLYWCH2 PE=1 SV=1
3	Q8IX15	3.2	33.5	550	0.034	0.044	HOMEZ_HUMAN Homeobox and leucine zipper protein Homez OS=Homo sapiens OX=9606 GN=HOMEZ PE=1 SV=2
4	A0A5S9MMK5	7.0	32.3	443	0.028	0.045	FPEB1_CAEEL FLYWCH-type zinc finger-containing protein peb-1 OS=Caenorhabditis elegans OX=6239 GN=peb-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08394 Arc_trans_TRASH	7.1e+02	12.0	Archaeal TRASH domain
2	PF11006 DUF2845	1.6e+02	13.8	Protein of unknown function (DUF2845)
3	PF04500 FLYWCH	6.5e-77	265.0	FLYWCH zinc finger domain
4	PF15423 FLYWCH_N	1.9e-52	187.2	FLYWCH-type zinc finger-containing protein
5	PF16662 FLYWCH_u	1.1e-34	129.5	FLYWCH-type zinc finger-containing protein 1
6	PF12019 GspH	26	16.7	Type II transport protein GspH
7	PF13408 Zn_ribbon_recom	2.7	19.9	Recombinase zinc beta ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000399938

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286918	0.775	Ankyrin repeat domain-containing protein 9
2	9606.ENSP00000309141	0.743	E3 ubiquitin-protein ligase MARCH3
3	9606.ENSP00000258787	0.725	Unconventional myosin-Ig
4	9606.ENSP00000323816	0.724	Aryl hydrocarbon receptor repressor
5	9606.ENSP00000289416	0.695	Acyl-coenzyme A synthetase ACSM3, mitochondrial
6	9606.ENSP00000424737	0.582	Protein ZGRF1
7	9606.ENSP00000359160	0.581	tRNA:m(4)X modification enzyme TRM13 homolog
8	9606.ENSP00000359768	0.561	E3 SUMO-protein ligase KIAA1586
9	9606.ENSP00000418721	0.551	Purine-rich element-binding protein gamma
10	9606.ENSP00000293851	0.545	Serine protease 33
11	9606.ENSP00000381298	0.538	LON peptidase N-terminal domain and ring finger 1
12	9606.ENSP00000333934	0.528	tRNA (guanine(10)-N2)-methyltransferase homolog
13	9606.ENSP00000386138	0.519	Olfactory receptor 1C1
14	9606.ENSP00000483239	0.517	Olfactory receptor 4M2
15	9606.ENSP00000457353	0.513	Probable crossover junction endonuclease EME2
16	9606.ENSP00000378248	0.509	CXXC-type zinc finger protein 4
17	9606.ENSP00000329467	0.506	Uncharacterized protein
18	9606.ENSP00000332500	0.503	Olfactory receptor 4N4
19	9606.ENSP00000480318	0.503	Olfactory receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003714	1.000	transcription corepressor activity
GO:0001223	1.000	transcription coactivator binding
GO:1901363	0.697	heterocyclic compound binding
GO:0097159	0.697	organic cyclic compound binding
GO:0003676	0.534	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.991	biological regulation
GO:0009987	0.985	cellular process
GO:0050794	0.979	regulation of cellular process
GO:0050896	0.949	response to stimulus
GO:0051716	0.941	cellular response to stimulus
GO:0031323	0.865	regulation of cellular metabolic process
GO:0048523	0.853	negative regulation of cellular process
GO:0080090	0.851	regulation of primary metabolic process
GO:0060255	0.851	regulation of macromolecule metabolic process
GO:0051171	0.851	regulation of nitrogen compound metabolic process
GO:0006974	0.847	cellular response to DNA damage stimulus
GO:0031324	0.671	negative regulation of cellular metabolic process
GO:0010468	0.664	regulation of gene expression
GO:0051252	0.657	regulation of RNA metabolic process
GO:0045892	0.652	negative regulation of DNA-templated transcription
GO:0006357	0.620	regulation of transcription by RNA polymerase II
GO:0000122	0.588	negative regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.999	protein-containing complex
GO:0005829	0.999	cytosol
GO:0005721	0.998	pericentric heterochromatin
GO:0005667	0.987	transcription regulator complex
GO:0016604	0.987	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]