StarFunc result for job id Q4VCS5

User Input

>input (1084 residues)
MRNSEEQPSGGTTVLQRLLQEQLRYGNPSENRSLLAIHQQATGNGPPFPSGSGNPGPQSD
VLSPQDHHQQLVAHAARQEPQGQEIQSENLIMEKQLSPRMQNNEELPTYEEAKVQSQYFR
GQQHASVGAAFYVTGVTNQKMRTEGRPSVQRLNPGKMHQDEGLRDLKQGHVRSLSERLMQ
MSLATSGVKAHPPVTSAPLSPPQPNDLYKNPTSSSEFYKAQGPLPNQHSLKGMEHRGPPP
EYPFKGMPPQSVVCKPQEPGHFYSEHRLNQPGRTEGQLMRYQHPPEYGAARPAQDISLPL
SARNSQPHSPTSSLTSGGSLPLLQSPPSTRLSPARHPLVPNQGDHSAHLPRPQQHFLPNQ
AHQGDHYRLSQPGLSQQQQQQQQQHHHHHHHQQQQQQQPQQQPGEAYSAMPRAQPSSASY
QPVPADPFAIVSRAQQMVEILSDENRNLRQELEGCYEKVARLQKVETEIQRVSEAYENLV
KSSSKREALEKAMRNKLEGEIRRMHDFNRDLRERLETANKQLAEKEYEGSEDTRKTISQL
FAKNKESQREKEKLEAELATARSTNEDQRRHIEIRDQALSNAQAKVVKLEEELKKKQVYV
DKVEKMQQALVQLQAACEKREQLEHRLRTRLERELESLRIQQRQGNCQPTNVSEYNAAAL
MELLREKEERILALEADMTKWEQKYLEENVMRHFALDAAATVAAQRDTTVISHSPNTSYD
TALEARIQKEEEEILMANKRCLDMEGRIKTLHAQIIEKDAMIKVLQQRSRKEPSKTEQLS
CMRPAKSLMSISNAGSGLLSHSSTLTGSPIMEEKRDDKSWKGSLGILLGGDYRAEYVPST
PSPVPPSTPLLSAHSKTGSRDCSTQTERGTESNKTAAVAPISVPAPVAAAATAAAITATA
ATITTTMVAAAPVAVAAAAAPAAAAAPSPATAAATAAAVSPAAAGQIPAAASVASAAAVA
PSAAAAAAVQVAPAAPAPVPAPALVPVPAPAAAQASAPAQTQAPTSAPAVAPTPAPTPTP
AVAQAEVPASPATGPGPHRLSIPSLTCNPDKTDGPVFHSNTLERKTPIQILGQEPDAEMV
EYLI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JX94	0.119	0.109	0.000	1191	0.882	0.803	A0A0G2JX94.pdb.gz	A0A0G2JX94_RAT Angiomotin OS=Rattus norvegicus OX=10116 GN=Amot PE=1 SV=2
2	AFDB:Q4VCS5	0.999	0.999	0.000	1084	1.000	1.000	Q4VCS5.pdb.gz	AMOT_HUMAN Angiomotin OS=Homo sapiens OX=9606 GN=AMOT PE=1 SV=1
3	AFDB:E9QFX4	0.201	0.214	1.778E-64	1009	0.516	0.554	E9QFX4.pdb.gz
4	AFDB:Q8IY63	0.181	0.201	7.577E-54	956	0.433	0.491	Q8IY63.pdb.gz	AMOL1_HUMAN Angiomotin-like protein 1 OS=Homo sapiens OX=9606 GN=AMOTL1 PE=1 SV=1
5	AFDB:Q9D4H4	0.158	0.174	2.109E-49	968	0.414	0.464	Q9D4H4.pdb.gz	AMOL1_MOUSE Angiomotin-like protein 1 OS=Mus musculus OX=10090 GN=Amotl1 PE=1 SV=2
6	AFDB:Q9SU08	0.045	0.053	2.009E-5	904	0.121	0.145	Q9SU08.pdb.gz	AUXI1_ARATH Auxilin-related protein 1 OS=Arabidopsis thaliana OX=3702 GN=AUXI1 PE=1 SV=2
7	AFDB:E7F5E1	0.061	0.049	2.873E-5	1367	0.156	0.124	E7F5E1.pdb.gz	CE162_DANRE Centrosomal protein of 162 kDa OS=Danio rerio OX=7955 GN=cep162 PE=2 SV=1
8	AFDB:E7EUS2	0.082	0.105	9.029E-5	836	0.101	0.132	E7EUS2.pdb.gz	E7EUS2_HUMAN Coiled-coil domain containing 110 OS=Homo sapiens OX=9606 GN=CCDC110 PE=1 SV=1
9	AFDB:P55937	0.090	0.067	9.699E-5	1487	0.121	0.088	P55937.pdb.gz	GOGA3_MOUSE Golgin subfamily A member 3 OS=Mus musculus OX=10090 GN=Golga3 PE=1 SV=3
10	AFDB:F4HQB9	0.096	0.105	2.289E-4	976	0.149	0.165	F4HQB9.pdb.gz	F4HQB9_ARATH Golgin Putative 5 OS=Arabidopsis thaliana OX=3702 GN=GC5 PE=1 SV=1
11	PDB:7r5jV0	0.054	0.178	5.167E-1	273	0.032	0.128	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
12	PDB:4v60A	0.070	0.087	6.794	812	0.032	0.043	4v60A.pdb.gz
13	PDB:6o9lQ	0.027	0.051	6.794	430	0.019	0.049	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
14	PDB:2m0qA	0.037	0.251	8.421	123	0.015	0.130	2m0qA.pdb.gz
15	PDB:6tdaS	0.041	0.056	9.045	783	0.025	0.034	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JX94	0.0	1573	1142	0.742	0.704	A0A0G2JX94_RAT Angiomotin OS=Rattus norvegicus OX=10116 GN=Amot PE=1 SV=2
2	A0A8C0SSK1	0.0	1606	1085	0.768	0.768	A0A8C0SSK1_CANLF Angiomotin OS=Canis lupus familiaris OX=9615 PE=1 SV=1
3	A2BDD9	0.0	1343	676	0.623	0.999	A2BDD9_HUMAN AMOT protein OS=Homo sapiens OX=9606 GN=AMOT PE=1 SV=1
4	A6NP16	0.0	1226	597	0.547	0.993	A6NP16_HUMAN Angiomotin OS=Homo sapiens OX=9606 GN=AMOT PE=1 SV=1
5	E7ERM3	0.0	1721	852	0.786	1.000	E7ERM3_HUMAN Angiomotin OS=Homo sapiens OX=9606 GN=AMOT PE=1 SV=1
6	E7F8Q6	0.0	842	968	0.500	0.560	E7F8Q6_DANRE Angiomotin OS=Danio rerio OX=7955 GN=amot PE=3 SV=3
7	Q4VCS5	0.0	2201	1084	1.000	1.000	AMOT_HUMAN Angiomotin OS=Homo sapiens OX=9606 GN=AMOT PE=1 SV=1
8	Q8VHG2	0.0	1559	1126	0.737	0.710	AMOT_MOUSE Angiomotin OS=Mus musculus OX=10090 GN=Amot PE=1 SV=3
9	Q8IY63	5.48e-175	540	956	0.265	0.300	AMOL1_HUMAN Angiomotin-like protein 1 OS=Homo sapiens OX=9606 GN=AMOTL1 PE=1 SV=1
10	Q9D4H4	1.60e-169	526	968	0.264	0.295	AMOL1_MOUSE Angiomotin-like protein 1 OS=Mus musculus OX=10090 GN=Amotl1 PE=1 SV=2
11	Q8K371	6.23e-113	370	772	0.217	0.304	AMOL2_MOUSE Angiomotin-like protein 2 OS=Mus musculus OX=10090 GN=Amotl2 PE=1 SV=1
12	A1YB07	3.80e-105	348	721	0.195	0.293	AMOL2_DANRE Angiomotin-like 2a OS=Danio rerio OX=7955 GN=amotl2a PE=1 SV=2
13	Q9Y2J4	1.05e-104	348	779	0.208	0.290	AMOL2_HUMAN Angiomotin-like protein 2 OS=Homo sapiens OX=9606 GN=AMOTL2 PE=1 SV=3
14	A0JMM4	2.83e-72	255	654	0.158	0.261	A0JMM4_DANRE Angiomotin like 2b OS=Danio rerio OX=7955 GN=zgc:154007 PE=2 SV=1
15	B8A5S6	3.34e-72	256	681	0.158	0.251	B8A5S6_DANRE Angiomotin like 2b isoform X1 OS=Danio rerio OX=7955 GN=zgc:154007 PE=3 SV=1
16	Q69ZZ9	4.85e-05	50.4	3305	0.052	0.017	K0754_MOUSE Microtubule-actin cross-linking factor 1, isoforms 6/7 OS=Mus musculus OX=10090 GN=Macf1 PE=2 SV=3
17	Q9P219	2.44e-04	47.8	2028	0.090	0.048	DAPLE_HUMAN Protein Daple OS=Homo sapiens OX=9606 GN=CCDC88C PE=1 SV=3
18	O75112	2.79e-04	47.4	727	0.038	0.056	LDB3_HUMAN LIM domain-binding protein 3 OS=Homo sapiens OX=9606 GN=LDB3 PE=1 SV=2
19	A9CQL4	4.74e-04	46.6	728	0.054	0.081	A9CQL4_CHLRE Centriole protein OS=Chlamydomonas reinhardtii OX=3055 GN=CrSAS-6 PE=1 SV=1
20	Q9JKS4	5.70e-04	46.6	723	0.038	0.057	LDB3_MOUSE LIM domain-binding protein 3 OS=Mus musculus OX=10090 GN=Ldb3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12240 Angiomotin_C	6e-92	318.2	Angiomotin C terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361027

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000289968	0.999	Rho GTPase-activating protein 17
2	9606.ENSP00000344666	0.999	Merlin
3	9606.ENSP00000360200	0.999	InaD-like protein
4	9606.ENSP00000478927	0.999	Transcriptional coactivator YAP1
5	9606.ENSP00000261681	0.996	MAGUK p55 subfamily member 5
6	9606.ENSP00000372035	0.992	Serine/threonine-protein kinase LATS2
7	9606.ENSP00000439807	0.992	Multiple PDZ domain protein
8	9606.ENSP00000437550	0.990	Serine/threonine-protein kinase LATS1
9	9606.ENSP00000419465	0.984	WW domain-containing transcription regulator protein 1
10	9606.ENSP00000387739	0.938	Angiomotin-like protein 1
11	9606.ENSP00000427772	0.938	Protein KIBRA
12	9606.ENSP00000324729	0.936	Protein salvador homolog 1
13	9606.ENSP00000424765	0.905	Angiomotin-like protein 2
14	9606.ENSP00000361892	0.868	Serine/threonine-protein kinase 4
15	9606.ENSP00000367830	0.855	Protein kinase C zeta type
16	9606.ENSP00000379364	0.848	MOB kinase activator 1A
17	9606.ENSP00000295797	0.835	Protein kinase C iota type
18	9606.ENSP00000383199	0.834	E3 ubiquitin-protein ligase NEDD4-like
19	9606.ENSP00000480499	0.834	E3 ubiquitin-protein ligase Itchy homolog
20	9606.ENSP00000457230	0.817	WW domain-containing oxidoreductase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.801	signaling receptor activity
GO:0043532	0.599	angiostatin binding
GO:0042802	0.369	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	1.000	cellular process
GO:0050789	0.999	regulation of biological process
GO:0050794	0.992	regulation of cellular process
GO:0050896	0.974	response to stimulus
GO:0007154	0.947	cell communication
GO:0048519	0.945	negative regulation of biological process
GO:0048522	0.939	positive regulation of cellular process
GO:0032501	0.934	multicellular organismal process
GO:0023052	0.903	signaling
GO:0051716	0.897	cellular response to stimulus
GO:0007165	0.877	signal transduction
GO:0016043	0.875	cellular component organization
GO:0051239	0.854	regulation of multicellular organismal process
GO:0032502	0.731	developmental process
GO:0048856	0.720	anatomical structure development
GO:0050793	0.611	regulation of developmental process
GO:0051128	0.609	regulation of cellular component organization
GO:0048523	0.585	negative regulation of cellular process
GO:0048870	0.578	cell motility
GO:0007275	0.507	multicellular organism development
GO:0048731	0.502	system development
GO:0035556	0.405	intracellular signal transduction
GO:0048583	0.402	regulation of response to stimulus
GO:0007010	0.389	cytoskeleton organization
GO:0010646	0.381	regulation of cell communication
GO:0023051	0.380	regulation of signaling
GO:0009653	0.380	anatomical structure morphogenesis
GO:0030029	0.359	actin filament-based process
GO:0019222	0.353	regulation of metabolic process
GO:0030036	0.348	actin cytoskeleton organization
GO:0065008	0.342	regulation of biological quality
GO:0060255	0.337	regulation of macromolecule metabolic process
GO:0009966	0.332	regulation of signal transduction
GO:0016477	0.329	cell migration
GO:0044087	0.327	regulation of cellular component biogenesis
GO:0033043	0.321	regulation of organelle organization
GO:2000145	0.314	regulation of cell motility
GO:0007163	0.310	establishment or maintenance of cell polarity
GO:0051171	0.306	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030054	0.999	cell junction
GO:0005654	0.997	nucleoplasm
GO:0005737	0.995	cytoplasm
GO:0005829	0.984	cytosol
GO:0070161	0.977	anchoring junction
GO:0071944	0.969	cell periphery
GO:0016020	0.963	membrane
GO:0043228	0.935	non-membrane-bounded organelle
GO:0043232	0.934	intracellular non-membrane-bounded organelle
GO:0005911	0.917	cell-cell junction
GO:0005886	0.913	plasma membrane
GO:0031982	0.893	vesicle
GO:0032991	0.736	protein-containing complex
GO:0043296	0.723	apical junction complex
GO:0070160	0.702	tight junction
GO:0120025	0.688	plasma membrane bounded cell projection
GO:0031410	0.674	cytoplasmic vesicle
GO:0005856	0.647	cytoskeleton
GO:0140513	0.614	nuclear protein-containing complex
GO:0005923	0.562	bicellular tight junction
GO:0098552	0.438	side of membrane
GO:0009897	0.433	external side of plasma membrane
GO:0031252	0.430	cell leading edge
GO:0099080	0.407	supramolecular complex
GO:0030139	0.378	endocytic vesicle
GO:0008180	0.363	COP9 signalosome
GO:0099512	0.328	supramolecular fiber
GO:0030027	0.313	lamellipodium
GO:0099513	0.300	polymeric cytoskeletal fiber

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]