StarFunc result for job id Q4VNC0

User Input

>input (1218 residues)
MEENSKKDHRALLNQGEEDELEVFGYRDHNVRKAFCLVASVLTCGGLLLVFYWRPQWRVW
ANCIPCPLQEADTVLLRTTDEFQRYMRKKVFCLYLSTLKFPVSKKWEESLVADRHSVINQ
ALIKPELKLRCMEVQKIRYVWNDLEKRFQKVGLLEDSNSCSDIHQTFGLGLTSEEQEVRR
LVCGPNAIEVEIQPIWKLLVKQVLNPFYVFQAFTLTLWLSQGYIEYSVAIIILTVISIVL
SVYDLRQQSVKLHNLVEDHNKVQVTIIVKDKGLEELESRLLVPGDILILPGKFSLPCDAV
LIDGSCVVNEGMLTGESIPVTKTPLPQMENTMPWKCHSLEDYRKHVLFCGTEVIQVKPSG
QGPVRAVVLQTGYNTAKGDLVRSILYPRPLNFKLYSDAFKFIVFLACLGVMGFFYALGVY
MYHGVPPKDTVTMALILLTVTVPPVLPAALTIGNVYAQKRLKKKKIFCISPQRINMCGQI
NLVCFDKTGTLTEDGLDLWGTVPTADNCFQEAHSFASGQAVPWSPLCAAMASCHSLILLN
GTIQGDPLDLKMFEGTAWKMEDCIVDSCKFGTSVSNIIKPGPKASKSPVEAIITLCQFPF
SSSLQRMSVIAQLAGENHFHVYMKGAPEMVARFCRSETVPKNFPQELRSYTVQGFRVIAL
AHKTLKMGNLSEVEHLAREKVESELTFLGLLIMENRLKKETKLVLKELSEARIRTVMITG
DNLQTAITVAKNSEMIPPGSQVIIVEADEPEEFVPASVTWQLVENQETGPGKKEIYMHTG
NSSTPRGEGGSCYHFAMSGKSYQVIFQHFNSLLPKILVNGTVFARMSPGQKSSLIEEFQK
LNYYVGMCGDGANDCGALKAAHAGISLSEQEASVASPFTSKTTNIQCVPHLIREGRAALV
SSFGVFKYLTMYGIIQFISALLLYWQLQLFGNYQYLMQDVAITLMVCLTMSSTHAYPKLA
PYRPAGQLLSPPLLLSIFLNSCFSCIVQISAFLYVKQQPWYCEVYQYSECFLANQSNFST
NVSLERNWTGNATLIPGSILSFETTTLWPITTINYITVAFIFSKGKPFRKPIYTNYIFSF
LLLAALGLTIFILFSDFQVIYRGMELIPTITSWRVLILVVALTQFCVAFFVEDSILQNHE
LWLLIKREFGFYSKSQYRTWQKKLAEDSTWPPINRTDYSGDGKNGFYINGGYESHEQIPK
RKLKLGGQPTEQHFWARL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4VNC0	1.000	1.000	0.000	1218	1.000	1.000	Q4VNC0.pdb.gz	AT135_HUMAN Probable cation-transporting ATPase 13A5 OS=Homo sapiens OX=9606 GN=ATP13A5 PE=2 SV=1
2	AFDB:Q4VNC1	0.923	0.939	0.000	1196	0.581	0.592	Q4VNC1.pdb.gz	AT134_HUMAN Probable cation-transporting ATPase 13A4 OS=Homo sapiens OX=9606 GN=ATP13A4 PE=2 SV=3
3	AFDB:Q5XF90	0.910	0.928	0.000	1193	0.581	0.593	Q5XF90.pdb.gz	AT134_MOUSE Probable cation-transporting ATPase 13A4 OS=Mus musculus OX=10090 GN=Atp13a4 PE=1 SV=1
4	AFDB:Q9H7F0	0.892	0.887	0.000	1226	0.411	0.409	Q9H7F0.pdb.gz	AT133_HUMAN Polyamine-transporting ATPase 13A3 OS=Homo sapiens OX=9606 GN=ATP13A3 PE=1 SV=4
5	AFDB:A0A2R8QKM0	0.845	0.879	1.919E-97	1170	0.373	0.388	A0A2R8QKM0.pdb.gz
6	AFDB:Q9NQ11	0.852	0.878	8.531E-97	1180	0.382	0.394	Q9NQ11.pdb.gz	AT132_HUMAN Polyamine-transporting ATPase 13A2 OS=Homo sapiens OX=9606 GN=ATP13A2 PE=1 SV=2
7	AFDB:H2L3J0	0.836	0.889	1.362E-94	1143	0.368	0.392	H2L3J0.pdb.gz	H2L3J0_ORYLA ATPase cation transporting 13A2 OS=Oryzias latipes OX=8090 GN=atp13a2 PE=3 SV=2
8	AFDB:F1MAA4	0.814	0.864	5.557E-93	1145	0.376	0.400	F1MAA4.pdb.gz	F1MAA4_RAT ATPase cation transporting 13A2 OS=Rattus norvegicus OX=10116 GN=Atp13a2 PE=3 SV=3
9	AFDB:Q27533	0.823	0.798	3.621E-90	1256	0.342	0.332	Q27533.pdb.gz	YH2M_CAEEL Probable cation-transporting ATPase W08D2.5 OS=Caenorhabditis elegans OX=6239 GN=W08D2.5 PE=3 SV=2
10	AFDB:Q21286	0.832	0.842	2.924E-89	1203	0.312	0.316	Q21286.pdb.gz	CATP5_CAEEL Cation-transporting ATPase catp-5 OS=Caenorhabditis elegans OX=6239 GN=catp-5 PE=2 SV=4
11	PDB:7vpkA	0.711	0.811	2.677E-81	1055	0.370	0.427	7vpkA.pdb.gz	Cryo-EM reveals mechanistic insights into lipid-facilitated polyamine export by human ATP13A2.
12	PDB:7m5xA	0.693	0.829	4.642E-75	1000	0.360	0.438	7m5xA.pdb.gz	Structural mechanisms for gating and ion selectivity of the human polyamine transporter ATP13A2.
13	PDB:6xmtA	0.600	0.660	6.730E-55	1092	0.227	0.254	6xmtA.pdb.gz	The endoplasmic reticulum P5A-ATPase is a transmembrane helix dislocase.
14	PDB:7e7sA	0.492	0.573	1.110E-36	1020	0.161	0.192	7e7sA.pdb.gz	Cryo-EM analysis provides new mechanistic insight into ATP binding to Ca 2+ -ATPase SERCA2b.
15	PDB:5zmwA	0.465	0.550	1.315E-34	1000	0.161	0.196	5zmwA.pdb.gz	Mechanism of the E2 to E1 transition in Ca2+pump revealed by crystal structures of gating residue mutants.
16	PDB:7x20A	0.521	0.622	1.108E-33	986	0.156	0.193	7x20A.pdb.gz	Structure and function of H + /K + pump mutants reveal Na + /K + pump mechanisms.
17	PDB:8d3xA	0.525	0.626	1.695E-31	989	0.162	0.199	8d3xA.pdb.gz	Structural basis for gating mechanism of the human sodium-potassium pump.
18	PDB:7py4A	0.484	0.523	2.949E-30	1112	0.132	0.145	7py4A.pdb.gz	Autoinhibition and regulation by phosphoinositides of ATP8B1, a human lipid flippase associated with intrahepatic cholestatic disorders.
19	PDB:3ixzA	0.504	0.599	3.077E-30	998	0.156	0.190	3ixzA.pdb.gz
20	PDB:6rohA	0.473	0.510	1.059E-29	1112	0.135	0.148	6rohA.pdb.gz	Structure and autoregulation of a P4-ATPase lipid flippase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZTP8	0.0	738	1133	0.372	0.400	A0A8I5ZTP8_RAT ATPase cation transporting 13A2 OS=Rattus norvegicus OX=10116 GN=Atp13a2 PE=3 SV=1
2	A1A5E5	0.0	775	1170	0.385	0.401	A1A5E5_DANRE Cation-transporting ATPase OS=Danio rerio OX=7955 GN=zgc:136762 PE=1 SV=1
3	B5DEH6	0.0	783	1145	0.383	0.407	B5DEH6_RAT Cation-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp13a2 PE=2 SV=1
4	F1MAA4	0.0	791	1173	0.389	0.404	F1MAA4_RAT ATPase cation transporting 13A2 OS=Rattus norvegicus OX=10116 GN=Atp13a2 PE=3 SV=3
5	F5GUA7	0.0	664	1207	0.333	0.336	F5GUA7_CAEEL Cation-transporting P-type ATPase N-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=catp-6 PE=1 SV=1
6	H2L3J0	0.0	748	1143	0.370	0.395	H2L3J0_ORYLA ATPase cation transporting 13A2 OS=Oryzias latipes OX=8090 GN=atp13a2 PE=3 SV=2
7	O74431	0.0	591	1315	0.310	0.287	ATC9_SCHPO Probable cation-transporting ATPase C1672.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1672.11c PE=3 SV=1
8	Q12697	0.0	606	1472	0.323	0.267	YPK9_YEAST Vacuolar cation-transporting ATPase YPK9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YPK9 PE=1 SV=1
9	Q21286	0.0	635	1203	0.333	0.337	CATP5_CAEEL Cation-transporting ATPase catp-5 OS=Caenorhabditis elegans OX=6239 GN=catp-5 PE=2 SV=4
10	Q27533	0.0	684	1256	0.353	0.342	YH2M_CAEEL Probable cation-transporting ATPase W08D2.5 OS=Caenorhabditis elegans OX=6239 GN=W08D2.5 PE=3 SV=2
11	Q4VNC0	0.0	2528	1218	1.000	1.000	AT135_HUMAN Probable cation-transporting ATPase 13A5 OS=Homo sapiens OX=9606 GN=ATP13A5 PE=2 SV=1
12	Q4VNC1	0.0	1428	1196	0.582	0.593	AT134_HUMAN Probable cation-transporting ATPase 13A4 OS=Homo sapiens OX=9606 GN=ATP13A4 PE=2 SV=3
13	Q5XF90	0.0	1434	1193	0.582	0.594	AT134_MOUSE Probable cation-transporting ATPase 13A4 OS=Mus musculus OX=10090 GN=Atp13a4 PE=1 SV=1
14	Q8N4D4	0.0	773	1088	0.368	0.412	Q8N4D4_HUMAN ATP13A2 protein (Fragment) OS=Homo sapiens OX=9606 GN=ATP13A2 PE=2 SV=1
15	Q9CTG6	0.0	785	1169	0.382	0.398	AT132_MOUSE Polyamine-transporting ATPase 13A2 OS=Mus musculus OX=10090 GN=Atp13a2 PE=2 SV=3
16	Q9H7F0	0.0	914	1226	0.415	0.412	AT133_HUMAN Polyamine-transporting ATPase 13A3 OS=Homo sapiens OX=9606 GN=ATP13A3 PE=1 SV=4
17	Q9NQ11	0.0	779	1180	0.385	0.397	AT132_HUMAN Polyamine-transporting ATPase 13A2 OS=Homo sapiens OX=9606 GN=ATP13A2 PE=1 SV=2
18	Q54X63	1.82e-179	561	1158	0.303	0.319	Q54X63_DICDI Cation-transporting ATPase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279183 PE=3 SV=1
19	D3YT44	9.10e-159	499	893	0.250	0.340	D3YT44_CAEEL Cation-transporting ATPase 13A3 OS=Caenorhabditis elegans OX=6239 GN=catp-6 PE=1 SV=1
20	A0A0G2JX15	2.04e-118	395	1050	0.179	0.208	A0A0G2JX15_RAT ATPase cation transporting 13A2 OS=Rattus norvegicus OX=10116 GN=Atp13a2 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13246 Cation_ATPase	0.00058	31.2	Cation transport ATPase (P-type)
2	PF00690 Cation_ATPase_N	0.00044	31.2	Cation transporter/ATPase, N-terminus
3	PF00122 E1-E2_ATPase	7e-31	118.7	E1-E2 ATPase
4	PF00702 Hydrolase	8.8e-13	60.6	haloacid dehalogenase-like hydrolase
5	PF12409 P5-ATPase	3.1e-25	100.2	P5-type ATPase cation transporter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000341942

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000392511	0.625	Proline rich transmembrane protein 3
2	9606.ENSP00000200135	0.588	Centromere/kinetochore protein zw10 homolog
3	9606.ENSP00000253697	0.576	Uncharacterized protein C3orf20
4	9606.ENSP00000304188	0.545	Olfactory receptor 8U1
5	9606.ENSP00000353850	0.508	Integrin beta-1-binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019829	1.000	ATPase-coupled monoatomic cation transmembrane transporter activity
GO:0140358	0.982	P-type transmembrane transporter activity
GO:0005488	0.975	binding
GO:0005515	0.948	protein binding
GO:0015318	0.869	inorganic molecular entity transmembrane transporter activity
GO:0022890	0.771	inorganic cation transmembrane transporter activity
GO:0015662	0.749	P-type ion transporter activity
GO:0046873	0.685	metal ion transmembrane transporter activity
GO:1901702	0.652	salt transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0051234	0.926	establishment of localization
GO:0006810	0.923	transport
GO:0006811	0.910	monoatomic ion transport
GO:0055085	0.795	transmembrane transport
GO:0034220	0.739	monoatomic ion transmembrane transport
GO:0065007	0.431	biological regulation
GO:0050789	0.366	regulation of biological process
GO:0008152	0.324	metabolic process
GO:0050794	0.314	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.995	membrane
GO:0071944	0.976	cell periphery
GO:0005886	0.943	plasma membrane
GO:0005622	0.909	intracellular anatomical structure
GO:0005737	0.892	cytoplasm
GO:0043226	0.885	organelle
GO:0012505	0.843	endomembrane system
GO:0043227	0.775	membrane-bounded organelle
GO:0043231	0.772	intracellular membrane-bounded organelle
GO:0031090	0.364	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	1.000	Translocases.

[back to server]