StarFunc result for job id Q4VNC1

User Input

>input (1196 residues)
MGHFEKGQHALLNEGEENEMEIFGYRTQGCRKSLCLAGSIFSFGILPLVFYWRPAWHVWA
HCVPCSLQEADTVLLRTTDEFQIYSWKKVIWIYLSALNSAFGLTPDHPLMTDEEYIINRA
IRKPDLKVRCIKVQKIRYVWNYLEGQFQKIGSLEDWLSSAKIHQKFGSGLTREEQEIRRL
ICGPNTIDVEVTPIWKLLIKEVLNPFYIFQLFSVCLWFSEDYKEYAFAIIIMSIISISLT
VYDLREQSVKLHHLVESHNSITVSVCGRKAGVQELESRVLVPGDLLILTGNKVLMPCDAV
LIEGSCVVDEGMLTGESIPVTKTPLPKMDSSVPWKTQSEADYKRHVLFCGTEVIQAKAAC
SGTVRAVVLQTGFNTAKGDLVRSILYPKPVNFQLYRDAIRFLLCLVGTATIGMIYTLCVY
VLSGEPPEEVVRKALDVITIAVPPALPAALTTGIIYAQRRLKKRGIFCISPQRINVCGQL
NLVCFDKTGTLTRDGLDLWGVVSCDRNGFQEVHSFASGQALPWGPLCAAMASCHSLILLD
GTIQGDPLDLKMFEATTWEMAFSGDDFHIKGVPAHAMVVKPCRTASQVPVEGIAILHQFP
FSSALQRMTVIVQEMGGDRLAFMKGAPERVASFCQPETVPTSFVSELQIYTTQGFRVIAL
AYKKLENDHHATTLTRETVESDLIFLGLLILENRLKEETKPVLEELISARIRTVMITGDN
LQTAITVARKSGMVSESQKVILIEANETTGSSSASISWTLVEEKKHIMYGNQDNYINIRD
EVSDKGREGSYHFALTGKSFHVISQHFSSLLPKILINGTIFARMSPGQKSSLVEEFQKLD
YFVGMCGDGANDCGALKMAHVGISLSEQEASVASPFTSKTPNIECVPHLIKEGRAALVTS
FCMFKYMALYSMIQYVGVLLLYWETNSLSNYQFLFQDLAITTLIGVTMNLNGAYPKLVPF
RPAGRLISPPLLLSVIFNILLSLAMHIAGFILVQRQPWYSVEIHSACTVQNESISELTMS
PTAPEKMESNSTFTSFENTTVWFLGTINCITVALVFSKGKPFRQPTYTNYIFVLVLIIQL
GVCLFILFADIPELYRRLDLLCTPVLWRASIVIMLSLNFIVSLVAEEAVIENRALWMMIK
RCFGYQSKSQYRIWQRDLANDPSWPPLNQTSHSDMPECGRGVSYSNPVFESNEEQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4VNC0	0.938	0.921	0.000	1218	0.591	0.580	Q4VNC0.pdb.gz	AT135_HUMAN Probable cation-transporting ATPase 13A5 OS=Homo sapiens OX=9606 GN=ATP13A5 PE=2 SV=1
2	AFDB:Q4VNC1	1.000	1.000	0.000	1196	1.000	1.000	Q4VNC1.pdb.gz	AT134_HUMAN Probable cation-transporting ATPase 13A4 OS=Homo sapiens OX=9606 GN=ATP13A4 PE=2 SV=3
3	AFDB:Q5XF90	0.962	0.964	0.000	1193	0.867	0.869	Q5XF90.pdb.gz	AT134_MOUSE Probable cation-transporting ATPase 13A4 OS=Mus musculus OX=10090 GN=Atp13a4 PE=1 SV=1
4	AFDB:Q9H7F0	0.900	0.878	0.000	1226	0.448	0.437	Q9H7F0.pdb.gz	AT133_HUMAN Polyamine-transporting ATPase 13A3 OS=Homo sapiens OX=9606 GN=ATP13A3 PE=1 SV=4
5	AFDB:A0A2R8QKM0	0.874	0.893	1.894E-102	1170	0.395	0.403	A0A2R8QKM0.pdb.gz
6	AFDB:H2L3J0	0.857	0.895	5.768E-101	1143	0.397	0.416	H2L3J0.pdb.gz	H2L3J0_ORYLA ATPase cation transporting 13A2 OS=Oryzias latipes OX=8090 GN=atp13a2 PE=3 SV=2
7	AFDB:Q9NQ11	0.883	0.895	3.389E-99	1180	0.392	0.397	Q9NQ11.pdb.gz	AT132_HUMAN Polyamine-transporting ATPase 13A2 OS=Homo sapiens OX=9606 GN=ATP13A2 PE=1 SV=2
8	AFDB:F1MAA4	0.851	0.888	4.273E-96	1145	0.380	0.397	F1MAA4.pdb.gz	F1MAA4_RAT ATPase cation transporting 13A2 OS=Rattus norvegicus OX=10116 GN=Atp13a2 PE=3 SV=3
9	AFDB:A0A0G2JX15	0.808	0.866	1.134E-92	1114	0.363	0.390	A0A0G2JX15.pdb.gz	A0A0G2JX15_RAT ATPase cation transporting 13A2 OS=Rattus norvegicus OX=10116 GN=Atp13a2 PE=3 SV=2
10	AFDB:Q27533	0.833	0.794	8.141E-92	1256	0.349	0.332	Q27533.pdb.gz	YH2M_CAEEL Probable cation-transporting ATPase W08D2.5 OS=Caenorhabditis elegans OX=6239 GN=W08D2.5 PE=3 SV=2
11	PDB:7vpkA	0.721	0.806	1.408E-84	1055	0.387	0.439	7vpkA.pdb.gz	Cryo-EM reveals mechanistic insights into lipid-facilitated polyamine export by human ATP13A2.
12	PDB:7m5xA	0.699	0.822	9.735E-79	1000	0.371	0.444	7m5xA.pdb.gz	Structural mechanisms for gating and ion selectivity of the human polyamine transporter ATP13A2.
13	PDB:6xmtA	0.616	0.666	7.734E-54	1092	0.232	0.255	6xmtA.pdb.gz	The endoplasmic reticulum P5A-ATPase is a transmembrane helix dislocase.
14	PDB:7e7sA	0.498	0.573	5.661E-38	1020	0.179	0.210	7e7sA.pdb.gz	Cryo-EM analysis provides new mechanistic insight into ATP binding to Ca 2+ -ATPase SERCA2b.
15	PDB:5zmwA	0.493	0.575	4.722E-36	1000	0.181	0.217	5zmwA.pdb.gz	Mechanism of the E2 to E1 transition in Ca2+pump revealed by crystal structures of gating residue mutants.
16	PDB:7x20A	0.508	0.601	1.610E-35	986	0.165	0.200	7x20A.pdb.gz	Structure and function of H + /K + pump mutants reveal Na + /K + pump mechanisms.
17	PDB:8d3xA	0.525	0.619	3.520E-33	989	0.161	0.194	8d3xA.pdb.gz	Structural basis for gating mechanism of the human sodium-potassium pump.
18	PDB:6rohA	0.504	0.536	2.690E-31	1112	0.155	0.166	6rohA.pdb.gz	Structure and autoregulation of a P4-ATPase lipid flippase.
19	PDB:3ixzA	0.503	0.589	3.348E-31	998	0.163	0.195	3ixzA.pdb.gz
20	PDB:7py4A	0.498	0.530	6.182E-31	1112	0.138	0.148	7py4A.pdb.gz	Autoinhibition and regulation by phosphoinositides of ATP8B1, a human lipid flippase associated with intrahepatic cholestatic disorders.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZTP8	0.0	725	1133	0.378	0.399	A0A8I5ZTP8_RAT ATPase cation transporting 13A2 OS=Rattus norvegicus OX=10116 GN=Atp13a2 PE=3 SV=1
2	A1A5E5	0.0	827	1170	0.406	0.415	A1A5E5_DANRE Cation-transporting ATPase OS=Danio rerio OX=7955 GN=zgc:136762 PE=1 SV=1
3	B5DEH6	0.0	763	1145	0.390	0.408	B5DEH6_RAT Cation-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp13a2 PE=2 SV=1
4	F1MAA4	0.0	769	1173	0.395	0.403	F1MAA4_RAT ATPase cation transporting 13A2 OS=Rattus norvegicus OX=10116 GN=Atp13a2 PE=3 SV=3
5	F5GUA7	0.0	657	1207	0.334	0.331	F5GUA7_CAEEL Cation-transporting P-type ATPase N-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=catp-6 PE=1 SV=1
6	H2L3J0	0.0	827	1143	0.406	0.425	H2L3J0_ORYLA ATPase cation transporting 13A2 OS=Oryzias latipes OX=8090 GN=atp13a2 PE=3 SV=2
7	O74431	0.0	630	1315	0.340	0.310	ATC9_SCHPO Probable cation-transporting ATPase C1672.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1672.11c PE=3 SV=1
8	Q12697	0.0	610	1472	0.326	0.265	YPK9_YEAST Vacuolar cation-transporting ATPase YPK9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YPK9 PE=1 SV=1
9	Q21286	0.0	660	1203	0.341	0.339	CATP5_CAEEL Cation-transporting ATPase catp-5 OS=Caenorhabditis elegans OX=6239 GN=catp-5 PE=2 SV=4
10	Q27533	0.0	683	1256	0.353	0.336	YH2M_CAEEL Probable cation-transporting ATPase W08D2.5 OS=Caenorhabditis elegans OX=6239 GN=W08D2.5 PE=3 SV=2
11	Q4VNC0	0.0	1427	1218	0.593	0.582	AT135_HUMAN Probable cation-transporting ATPase 13A5 OS=Homo sapiens OX=9606 GN=ATP13A5 PE=2 SV=1
12	Q4VNC1	0.0	2480	1196	1.000	1.000	AT134_HUMAN Probable cation-transporting ATPase 13A4 OS=Homo sapiens OX=9606 GN=ATP13A4 PE=2 SV=3
13	Q54X63	0.0	602	1158	0.330	0.341	Q54X63_DICDI Cation-transporting ATPase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279183 PE=3 SV=1
14	Q5XF90	0.0	2149	1193	0.870	0.872	AT134_MOUSE Probable cation-transporting ATPase 13A4 OS=Mus musculus OX=10090 GN=Atp13a4 PE=1 SV=1
15	Q8N4D4	0.0	769	1088	0.374	0.411	Q8N4D4_HUMAN ATP13A2 protein (Fragment) OS=Homo sapiens OX=9606 GN=ATP13A2 PE=2 SV=1
16	Q9CTG6	0.0	760	1169	0.391	0.400	AT132_MOUSE Polyamine-transporting ATPase 13A2 OS=Mus musculus OX=10090 GN=Atp13a2 PE=2 SV=3
17	Q9H7F0	0.0	1007	1226	0.456	0.445	AT133_HUMAN Polyamine-transporting ATPase 13A3 OS=Homo sapiens OX=9606 GN=ATP13A3 PE=1 SV=4
18	Q9NQ11	0.0	779	1180	0.393	0.398	AT132_HUMAN Polyamine-transporting ATPase 13A2 OS=Homo sapiens OX=9606 GN=ATP13A2 PE=1 SV=2
19	D3YT44	4.78e-157	494	893	0.249	0.334	D3YT44_CAEEL Cation-transporting ATPase 13A3 OS=Caenorhabditis elegans OX=6239 GN=catp-6 PE=1 SV=1
20	A0A0G2JX15	2.18e-120	400	1050	0.186	0.211	A0A0G2JX15_RAT ATPase cation transporting 13A2 OS=Rattus norvegicus OX=10116 GN=Atp13a2 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13246 Cation_ATPase	0.045	25.1	Cation transport ATPase (P-type)
2	PF00690 Cation_ATPase_N	1.3e-05	36.1	Cation transporter/ATPase, N-terminus
3	PF10941 DUF2620	9.2	17.8	Protein of unknown function DUF2620
4	PF00122 E1-E2_ATPase	2.6e-29	113.6	E1-E2 ATPase
5	PF00702 Hydrolase	6.9e-10	51.1	haloacid dehalogenase-like hydrolase
6	PF12409 P5-ATPase	2.5e-26	103.7	P5-type ATPase cation transporter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000339182

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000392511	0.625	Proline rich transmembrane protein 3
2	9606.ENSP00000256538	0.594	Diphthine--ammonia ligase
3	9606.ENSP00000367459	0.567	Dyslexia-associated protein KIAA0319
4	9606.ENSP00000292079	0.556	Sodium/potassium-transporting ATPase subunit gamma
5	9606.ENSP00000264638	0.521	Contactin-associated protein 1
6	9606.ENSP00000386209	0.519	Olfactory receptor 2A2
7	9606.ENSP00000328215	0.517	Olfactory receptor 56A4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019829	1.000	ATPase-coupled monoatomic cation transmembrane transporter activity
GO:0046873	0.985	metal ion transmembrane transporter activity
GO:0140358	0.974	P-type transmembrane transporter activity
GO:1901702	0.962	salt transmembrane transporter activity
GO:0015662	0.958	P-type ion transporter activity
GO:0005488	0.952	binding
GO:0005515	0.695	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0006810	0.938	transport
GO:0006811	0.848	monoatomic ion transport
GO:0034220	0.836	monoatomic ion transmembrane transport
GO:0048878	0.411	chemical homeostasis
GO:0050801	0.392	monoatomic ion homeostasis
GO:0006873	0.379	intracellular monoatomic ion homeostasis
GO:0055080	0.371	monoatomic cation homeostasis
GO:0065007	0.366	biological regulation
GO:0030003	0.341	intracellular monoatomic cation homeostasis
GO:0006812	0.334	monoatomic cation transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0012505	0.996	endomembrane system
GO:0005886	0.975	plasma membrane
GO:0043227	0.957	membrane-bounded organelle
GO:0005737	0.946	cytoplasm
GO:0043231	0.944	intracellular membrane-bounded organelle
GO:0031090	0.894	organelle membrane
GO:0031982	0.772	vesicle
GO:0030659	0.370	cytoplasmic vesicle membrane
GO:0010008	0.351	endosome membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	1.000	Translocases.

[back to server]