StarFunc result for job id Q4VXA5

User Input

>input (237 residues)
MLSAFQRLFRVLFVIETVSEYGVLIFIYGWPFLQTLAMLLIGTVSFHLWIRRNRERNSRS
GKTRCRSKRSEQSMDMGTSALSKKPWWTLPQNFHAPMVFHMEEDQEELIFGHGDTYLRCI
EVHSHTLIQLESWFTATGQTRVTVVGPHRARQWLLHMFCCVGSQDSYHHARGLEMLERVR
SQPLTNDDLVTSISVPPYTGDLSLAPRISGTVCLSVPQPSPYQVIGCSGFHLSSLYP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0C7A0	0.467	0.863	6.513E-14	126	0.266	0.500	P0C7A0.pdb.gz	KHD1B_MOUSE KH homology domain-containing protein 1B OS=Mus musculus OX=10090 GN=Khdc1b PE=2 SV=1
2	AFDB:Q3UWR2	0.460	0.653	7.351E-14	166	0.274	0.392	Q3UWR2.pdb.gz	KHD1A_MOUSE KH homology domain-containing protein 1A OS=Mus musculus OX=10090 GN=Khdc1a PE=2 SV=1
3	AFDB:A6NGQ2	0.301	0.459	7.183E-5	149	0.118	0.188	A6NGQ2.pdb.gz	OOEP_HUMAN Oocyte-expressed protein homolog OS=Homo sapiens OX=9606 GN=OOEP PE=1 SV=3
4	AFDB:Q9CQS7	0.246	0.462	1.578E-4	118	0.076	0.153	Q9CQS7.pdb.gz	DPA5A_MOUSE Developmental pluripotency-associated protein 5A OS=Mus musculus OX=10090 GN=Dppa5a PE=1 SV=2
5	AFDB:Q86TM3	0.197	0.081	3.465E-4	631	0.080	0.030	Q86TM3.pdb.gz	DDX53_HUMAN Probable ATP-dependent RNA helicase DDX53 OS=Homo sapiens OX=9606 GN=DDX53 PE=1 SV=3
6	AFDB:Q9CWU5	0.295	0.168	4.983E-4	440	0.143	0.077	Q9CWU5.pdb.gz	KHDC3_MOUSE KH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Khdc3 PE=1 SV=1
7	AFDB:Q9CWE6	0.241	0.335	7.612E-4	164	0.084	0.122	Q9CWE6.pdb.gz	OOEP_MOUSE Oocyte-expressed protein homolog OS=Mus musculus OX=10090 GN=Ooep PE=1 SV=1
8	AFDB:Q9XW13	0.249	0.128	1.312E-3	507	0.093	0.043	Q9XW13.pdb.gz	MXT_CAEEL Eukaryotic translation initiation factor 4E-binding protein Mextli homolog OS=Caenorhabditis elegans OX=6239 GN=mxt-1 PE=1 SV=1
9	AFDB:Q587J8	0.307	0.333	2.130E-3	217	0.152	0.166	Q587J8.pdb.gz	KHDC3_HUMAN KH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=KHDC3L PE=1 SV=1
10	AFDB:A0A0A0MQZ8	0.237	0.077	2.404E-3	866	0.110	0.030	A0A0A0MQZ8.pdb.gz	A0A0A0MQZ8_HUMAN Ankyrin repeat and KH domain containing 1 OS=Homo sapiens OX=9606 GN=ANKHD1 PE=1 SV=1
11	PDB:6ql5I	0.234	0.036	7.152E-2	2036	0.038	0.004	6ql5I.pdb.gz	Discovery of a Regulatory Subunit of the Yeast Fatty Acid Synthase.
12	PDB:6zqbJO	0.254	0.255	1.669E-1	236	0.038	0.038	6zqbJO.pdb.gz	90 S pre-ribosome transformation into the primordial 40 S subunit.
13	PDB:7dcmA	0.184	0.229	2.878E-1	182	0.063	0.082	7dcmA.pdb.gz	Co-evolution-based prediction of metal-binding sites in proteomes by machine learning.
14	PDB:6ke6RC	0.214	0.185	3.895E-1	278	0.055	0.047	6ke6RC.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
15	PDB:4v6xCX	0.120	0.198	4.138E-1	121	0.038	0.074	4v6xCX.pdb.gz	Structures of the human and Drosophila 80S ribosome.
16	PDB:6qm5A	0.169	0.073	4.138E-1	673	0.076	0.027	6qm5A.pdb.gz	Stepwise activation mechanism of the scramblase nhTMEM16 revealed by cryo-EM.
17	PDB:7ajuJJ	0.159	0.185	4.138E-1	199	0.046	0.055	7ajuJJ.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
18	PDB:6oy3B	0.170	0.082	4.670E-1	594	0.068	0.027	6oy3B.pdb.gz	Dynamic modulation of the lipid translocation groove generates a conductive ion channel in Ca 2+ -bound nhTMEM16.
19	PDB:7mq8NY	0.255	0.225	4.670E-1	274	0.051	0.044	7mq8NY.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:3j79Y	0.133	0.257	4.961E-1	101	0.034	0.079	3j79Y.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0C7A0	1.24e-38	132	126	0.262	0.492	KHD1B_MOUSE KH homology domain-containing protein 1B OS=Mus musculus OX=10090 GN=Khdc1b PE=2 SV=1
2	Q3UWR2	1.53e-37	130	166	0.278	0.398	KHD1A_MOUSE KH homology domain-containing protein 1A OS=Mus musculus OX=10090 GN=Khdc1a PE=2 SV=1
3	A6NGQ2	0.016	37.4	149	0.110	0.174	OOEP_HUMAN Oocyte-expressed protein homolog OS=Homo sapiens OX=9606 GN=OOEP PE=1 SV=3
4	P32715	2.8	31.6	683	0.059	0.020	MDTO_ECOLI Multidrug resistance protein MdtO OS=Escherichia coli (strain K12) OX=83333 GN=mdtO PE=1 SV=2
5	Q9I594	3.0	31.6	735	0.122	0.039	Q9I594_PSEAE Diguanylate cyclase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA0847 PE=4 SV=1
6	Q9CWE6	3.5	30.4	164	0.089	0.128	OOEP_MOUSE Oocyte-expressed protein homolog OS=Mus musculus OX=10090 GN=Ooep PE=1 SV=1
7	O75762	8.8	30.0	1119	0.080	0.017	TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens OX=9606 GN=TRPA1 PE=1 SV=3
8	Q8C636	9.4	30.0	571	0.063	0.026	SPT16_MOUSE Spermatogenesis-associated protein 16 OS=Mus musculus OX=10090 GN=Spata16 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16005 MOEP19	3.6e-25	99.1	KH-like RNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359411

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359392	0.924	KHDC3-like protein
2	9606.ENSP00000359396	0.924	Developmental pluripotency-associated 5 protein
3	9606.ENSP00000359384	0.920	Oocyte-expressed protein homolog
4	9606.ENSP00000354085	0.595	Ankyrin repeat and KH domain-containing protein 1
5	9606.ENSP00000411084	0.556	Zinc finger protein 799
6	9606.ENSP00000359434	0.544	Protein CXorf40B
7	9606.ENSP00000302202	0.518	Uncharacterized protein C2orf15

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.993	regulation of biological process
GO:0080090	0.975	regulation of primary metabolic process
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0051171	0.975	regulation of nitrogen compound metabolic process
GO:0048518	0.974	positive regulation of biological process
GO:0009893	0.958	positive regulation of metabolic process
GO:0051173	0.954	positive regulation of nitrogen compound metabolic process
GO:0010604	0.949	positive regulation of macromolecule metabolic process
GO:0050794	0.862	regulation of cellular process
GO:0051246	0.720	regulation of protein metabolic process
GO:0048522	0.677	positive regulation of cellular process
GO:0009987	0.612	cellular process
GO:0031323	0.579	regulation of cellular metabolic process
GO:0031325	0.488	positive regulation of cellular metabolic process
GO:0050790	0.433	regulation of catalytic activity
GO:0048583	0.417	regulation of response to stimulus
GO:0019219	0.373	regulation of nucleobase-containing compound metabolic process
GO:0030162	0.362	regulation of proteolysis
GO:0051247	0.362	positive regulation of protein metabolic process
GO:0051336	0.353	regulation of hydrolase activity
GO:0048584	0.347	positive regulation of response to stimulus
GO:0050896	0.344	response to stimulus
GO:0080134	0.341	regulation of response to stress
GO:0052547	0.339	regulation of peptidase activity
GO:0032501	0.329	multicellular organismal process
GO:0045935	0.319	positive regulation of nucleobase-containing compound metabolic process
GO:2001020	0.304	regulation of response to DNA damage stimulus
GO:0043085	0.301	positive regulation of catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0032991	0.959	protein-containing complex
GO:0043227	0.955	membrane-bounded organelle
GO:0043229	0.953	intracellular organelle
GO:0043231	0.936	intracellular membrane-bounded organelle
GO:0005634	0.825	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]