StarFunc result for job id Q4VXU2

User Input

>input (614 residues)
MNASGSGYPLASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDVATRRSLGYAYINFQ
QPADAERALDTMNFEMLKGQPIRIMWSQRDPGLRKSGVGNIFIKNLEDSIDNKALYDTFS
TFGNILSCKVACDEHGSRGFGFVHFETHEAAQQAINTMNGMLLNDRKVFVGHFKSRRERE
AELGARALEFTNIYVKNLPVDVDEQGLQDLFSQFGKMLSVKVMRDNSGHSRCFGFVNFEK
HEEAQKAVVHMNGKEVSGRLLYAGRAQKRVERQNELKRRFEQMKQDRLRRYQGVNLYVKN
LDDSIDDDKLRKEFSPYGVITSAKVMTEGGHSKGFGFVCFSSPEEATKAVTEMNGRIVGT
KPLYVALAQRKEERKAILTNQYMQRLSTMRTLSNPLLGSFQQPSSYFLPAMPQPPAQAAY
YGCGPVTPTQPAPRWTSQPPRPSCASMVRPPVVPRRPPAHISSVRQASTQVPRTVPHTQR
VANIGTQTTGPSGVGCCTPGRPLLPCKCSSAAHSTYRVQEPAVHIPGQEPLTASMLAAAP
LHEQKQMIGERLYPLIHDVHTQLAGKITGMLLEIDNSELLLMLESPESLHAKIDEAVAVL
QAHQAMEQPKAYMH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4VXU2	1.000	1.000	0.000	614	1.000	1.000	Q4VXU2.pdb.gz	PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens OX=9606 GN=PABPC1L PE=2 SV=1
2	AFDB:Q98SP8	0.615	0.603	1.657E-94	629	0.741	0.723	Q98SP8.pdb.gz	EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis OX=8355 GN=epabp-a PE=1 SV=2
3	AFDB:A2A5N3	0.672	0.679	1.436E-92	607	0.764	0.773	A2A5N3.pdb.gz	A2A5N3_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc1l PE=2 SV=1
4	AFDB:Q6TGY6	0.688	0.682	1.376E-91	620	0.713	0.706	Q6TGY6.pdb.gz
5	AFDB:A0A024R9C1	0.692	0.670	1.550E-91	636	0.700	0.676	A0A024R9C1.pdb.gz
6	AFDB:H0YAR2	0.536	0.548	4.086E-90	599	0.679	0.696	H0YAR2.pdb.gz	H0YAR2_HUMAN Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2
7	AFDB:A3KFU5	0.671	0.655	1.143E-88	631	0.663	0.645	A3KFU5.pdb.gz	A3KFU5_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=1 SV=1
8	AFDB:Q6PHQ9	0.746	0.697	2.072E-88	660	0.673	0.626	Q6PHQ9.pdb.gz	Q6PHQ9_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=1 SV=1
9	AFDB:Q62029	0.413	0.405	3.230E-83	628	0.617	0.604	Q62029.pdb.gz	Q62029_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc2 PE=1 SV=1
10	AFDB:P21187	0.479	0.466	1.433E-75	634	0.542	0.525	P21187.pdb.gz	PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster OX=7227 GN=pAbp PE=1 SV=3
11	PDB:6r5kH	0.361	0.523	4.990E-37	394	0.352	0.548	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
12	PDB:5vsuA	0.202	0.282	1.649E-22	387	0.119	0.189	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
13	PDB:6y53o	0.145	0.452	7.766E-15	160	0.104	0.400	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
14	PDB:7oqcF	0.124	0.280	1.327E-14	267	0.080	0.184	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
15	PDB:5lsbA	0.128	0.410	4.436E-13	176	0.080	0.278	5lsbA.pdb.gz
16	PDB:7evoD	0.129	0.388	6.727E-13	200	0.081	0.250	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
17	PDB:6y5qq	0.120	0.393	1.190E-10	178	0.057	0.197	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
18	PDB:6ff7X	0.123	0.422	1.013E-9	171	0.062	0.222	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
19	PDB:6gd1A	0.126	0.395	2.104E-8	190	0.050	0.163	6gd1A.pdb.gz
20	PDB:5yzg1	0.126	0.315	4.839E-8	243	0.075	0.189	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A087WTT1	718	588	0.614	0.641	A0A087WTT1_HUMAN Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2
2	A2A5N3	916	607	0.765	0.774	A2A5N3_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc1l PE=2 SV=1
3	A3KFU5	817	631	0.679	0.661	A3KFU5_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=1 SV=1
4	A3KFU8	811	644	0.668	0.637	A3KFU8_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=1 SV=1
5	B1ANR0	820	615	0.676	0.675	B1ANR0_HUMAN Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC4 PE=1 SV=1
6	B2RXY9	918	607	0.767	0.776	B2RXY9_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc1l PE=2 SV=1
7	E7EQV3	792	591	0.638	0.663	E7EQV3_HUMAN Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1
8	E7ERJ7	797	604	0.660	0.671	E7ERJ7_HUMAN Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1
9	F1QB54	837	634	0.676	0.655	PABPA_DANRE Polyadenylate-binding protein 1A OS=Danio rerio OX=7955 GN=pabpc1a PE=1 SV=1
10	H0Y5F5	618	550	0.539	0.602	H0Y5F5_HUMAN Polyadenylate-binding protein (Fragment) OS=Homo sapiens OX=9606 GN=PABPC4 PE=1 SV=1
11	H0YAR2	845	599	0.682	0.699	H0YAR2_HUMAN Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2
12	P11940	877	636	0.702	0.678	PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2
13	P20965	848	633	0.689	0.668	PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis OX=8355 GN=pabpc1-a PE=1 SV=3
14	P21187	632	634	0.562	0.544	PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster OX=7227 GN=pAbp PE=1 SV=3
15	P29341	875	636	0.700	0.676	PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus OX=10090 GN=Pabpc1 PE=1 SV=2
16	P31209	544	653	0.482	0.453	PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pab1 PE=1 SV=2
17	P61286	877	636	0.702	0.678	PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus OX=9913 GN=PABPC1 PE=2 SV=1
18	Q13310	816	644	0.668	0.637	PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4 PE=1 SV=1
19	Q19579	565	692	0.515	0.457	Q19579_CAEEL Polyadenylate-binding protein OS=Caenorhabditis elegans OX=6239 GN=pab-2 PE=1 SV=1
20	Q3UX16	679	590	0.583	0.607	Q3UX16_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11608 MARF1_RRM1	0.005	28.3	MARF1, RNA recognition motif 1
2	PF14605 Nup35_RRM_2	0.37	22.2	Nup53/35/40-type RNA recognition motif
3	PF08206 OB_RNB	2.8e+02	12.6	Ribonuclease B OB domain
4	PF00658 PABP	2.9e-24	96.2	Poly-adenylate binding protein, unique domain
5	PF00076 RRM_1	6.1e-86	293.6	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
6	PF13893 RRM_5	2.2e-06	38.8	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
7	PF16367 RRM_7	1.5e-07	42.7	RNA recognition motif
8	PF16842 RRM_occluded	0.1	23.8	Occluded RNA-recognition motif
9	PF11767 SET_assoc	0.0038	28.2	Histone lysine methyltransferase SET associated

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000255136

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302768	0.952	Polyadenylate-binding protein-interacting protein 1
2	9606.ENSP00000477715	0.950	Cytoplasmic polyadenylation element-binding protein 1
3	9606.ENSP00000416255	0.931	Eukaryotic translation initiation factor 4 gamma 1
4	9606.ENSP00000250863	0.852	Deleted in azoospermia-like
5	9606.ENSP00000397563	0.843	Poly(A) RNA polymerase GLD2
6	9606.ENSP00000279068	0.793	Protein LSM14 homolog B
7	9606.ENSP00000446271	0.779	Protein LSM14 homolog A
8	9606.ENSP00000245934	0.777	Symplekin
9	9606.ENSP00000425561	0.772	Eukaryotic translation initiation factor 4E
10	9606.ENSP00000338173	0.761	Pumilio homolog 2
11	9606.ENSP00000387911	0.755	Poly(A)-specific ribonuclease PARN
12	9606.ENSP00000323714	0.748	Eukaryotic translation initiation factor 4E type 1B
13	9606.ENSP00000383274	0.743	Eukaryotic translation initiation factor 4 gamma 3
14	9606.ENSP00000388806	0.740	Eukaryotic translation initiation factor 4B
15	9606.ENSP00000356520	0.721	ATP-dependent RNA helicase A
16	9606.ENSP00000370345	0.712	PAN2-PAN3 deadenylation complex subunit PAN3
17	9606.ENSP00000478754	0.693	Probable ATP-dependent RNA helicase DDX6
18	9606.ENSP00000408598	0.673	Embryonic polyadenylate-binding protein 2
19	9606.ENSP00000244221	0.663	Polyadenylate-binding protein-interacting protein 2B
20	9606.ENSP00000336783	0.631	Trinucleotide repeat-containing gene 6C protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0005515	0.997	protein binding
GO:0003729	0.970	mRNA binding
GO:0070717	0.921	poly-purine tract binding
GO:0008143	0.911	poly(A) binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010468	0.995	regulation of gene expression
GO:0009987	0.988	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0080090	0.982	regulation of primary metabolic process
GO:0051171	0.982	regulation of nitrogen compound metabolic process
GO:0031323	0.982	regulation of cellular metabolic process
GO:1903311	0.948	regulation of mRNA metabolic process
GO:0010608	0.931	post-transcriptional regulation of gene expression
GO:0061013	0.887	regulation of mRNA catabolic process
GO:0071704	0.857	organic substance metabolic process
GO:0043487	0.849	regulation of RNA stability
GO:0043488	0.842	regulation of mRNA stability
GO:0044237	0.730	cellular metabolic process
GO:0044238	0.727	primary metabolic process
GO:0006807	0.721	nitrogen compound metabolic process
GO:0043170	0.676	macromolecule metabolic process
GO:0032502	0.671	developmental process
GO:0034641	0.624	cellular nitrogen compound metabolic process
GO:0048856	0.605	anatomical structure development
GO:0048518	0.496	positive regulation of biological process
GO:0046483	0.483	heterocycle metabolic process
GO:1901360	0.482	organic cyclic compound metabolic process
GO:0048519	0.467	negative regulation of biological process
GO:0016070	0.467	RNA metabolic process
GO:0010604	0.441	positive regulation of macromolecule metabolic process
GO:0010467	0.417	gene expression
GO:0016071	0.369	mRNA metabolic process
GO:0010605	0.366	negative regulation of macromolecule metabolic process
GO:0048468	0.348	cell development
GO:0048523	0.344	negative regulation of cellular process
GO:0031324	0.329	negative regulation of cellular metabolic process
GO:0010556	0.326	regulation of macromolecule biosynthetic process
GO:0006396	0.320	RNA processing
GO:0031326	0.318	regulation of cellular biosynthetic process
GO:0051172	0.312	negative regulation of nitrogen compound metabolic process
GO:0051246	0.302	regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.996	membrane-bounded organelle
GO:0005622	0.979	intracellular anatomical structure
GO:0005829	0.950	cytosol
GO:0032991	0.899	protein-containing complex
GO:0005634	0.882	nucleus
GO:0005576	0.523	extracellular region
GO:0070013	0.461	intracellular organelle lumen
GO:0031982	0.449	vesicle
GO:0005615	0.384	extracellular space
GO:0043230	0.384	extracellular organelle
GO:0065010	0.356	extracellular membrane-bounded organelle
GO:0070062	0.335	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]