StarFunc result for job id Q4ZG55

User Input

>input (1949 residues)
MGNSYAGQLKTTRFEEVLHNSIEASLRSNNLVPRPIFSQLYLEAEQQLAALEGGSRVDNE
EEEEEGEGGLETNGPPNPFQLHPLPEGCCTTDGFCQAGKDLRLVSISNEPMDVPAGFLLV
GVKSPSLPDHLLVCAVDKRFLPDDNGHNALLGFSGNCVGCGKKGFCYFTEFSNHINLKLT
TQPKKQKHLKYYLVRNAQGTLTKGPLICWKGSEFRSRQIPASTCSSSLFPALESTAAFPS
EPVPGTNPSILMGAQQAGPASDHPSLNAAMGPAVFNGKDSPKCQQLAKNNLLALPRPSAL
GILSNSGPPKKRHKGWSPESPSAPDGGCPQGGGNRAKYESAGMSCVPQVGLVGPASVTFP
VVASGEPVSVPDNLLKICKAKPVIFKGHGNFPYLCGNLNDVVVSPLLYTCYQNSQSVSRA
YEQYGASAIQPISEEMQLLLTVYYLVQLAADQVPLMEDLEQIFLRSWRESHLTEIRQYQQ
APPQPFPPAPSAAAPVTSAQLPWLASLAASSCNDSVHVIECAYSLAEGLSEMFRLLVEGK
LAKTNYVVIICACRSAAIDSCIAVTGKYQARILSESLLTPAEYQKEVNYELVTGKVDSLG
AFFSTLCPEGDIDILLDKFHQENQGHISSSLAASSVTKAASLDVSGTPVCTSYNLEPHSI
RPFQLAVAQKLLSHVCSIADSSTQNLDLGSFEKVDFLICIPPSEVTYQQTLLHVWHSGVL
LELGLKKEHMTKQRVEQYVLKLDTEAQTKFKAFLQNSFQNPHTLFVLIHDHAHWDLVSST
VHNLYSQSDPSVGLVDRLLNCREVKEAPNIVTLHVTSFPYALQTQHTLISPYNEIHWPAS
CSNGVDLYHENKKYFGLSEFIESTLSGHSLPLLRYDSSFEAMVTALGKRFPRLHSAVIRT
FVLVQHYAAALMAVSGLPQMKNYTSVETLEITQNLLNSPKQCPCGHGLMVLLRVPCSPLA
VVAYERLAHVRARLALEEHFEIILGSPSSGVTVGKHFVKQLRMWQKIEDVEWRPQTYLEL
EGLPCILIFSGMDPHGESLPRSLRYCDLRLINSSCLVRTALEQELGLAAYFVSNEVPLEK
GARNEALESDAEKLSSTDNEDEELGTEGSTSEKRSPMKRERSRSHDSASSSLSSKASGSA
LGGESSAQPTALPQGEHARSPQPRGPAEEGRAPGEKQRPRASQGPPSAISRHSPGPTPQP
DCSLRTGQRSVQVSVTSSCSQLSSSSGSSSSSVAPAAGTWVLQASQCSLTKACRQPPIVF
LPKLVYDMVVSTDSSGLPKAASLLPSPSVMWASSFRPLLSKTMTSTEQSLYYRQWTVPRP
SHMDYGNRAEGRVDGFHPRRLLLSGPPQIGKTGAYLQFLSVLSRMLVRLTEVDVYDEEEI
NINLREESDWHYLQLSDPWPDLELFKKLPFDYIIHDPKYEDASLICSHYQGIKSEDRGMS
RKPEDLYVRRQTARMRLSKYAAYNTYHHCEQCHQYMGFHPRYQLYESTLHAFAFSYSMLG
EEIQLHFIIPKSKEHHFVFSQPGGQLESMRLPLVTDKSHEYIKSPTFTPTTGRHEHGLFN
LYHAMDGASHLHVLVVKEYEMAIYKKYWPNHIMLVLPSIFNSAGVGAAHFLIKELSYHNL
ELERNRQEELGIKPQDIWPFIVISDDSCVMWNVVDVNSAGERSREFSWSERNVSLKHIMQ
HIEAAPDIMHYALLGLRKWSSKTRASEVQEPFSRCHVHNFIILNVDLTQNVQYNQNRFLC
DDVDFNLRVHSAGLLLCRFNRFSVMKKQIVVGGHRSFHITSKVSDNSAAVVPAQYICAPD
SKHTFLAAPAQLLLEKFLQHHSHLFFPLSLKNHDHPVLSVDCYLNLGSQISVCYVSSRPH
SLNISCSDLLFSGLLLYLCDSFVGASFLKKFHFLKGATLCVICQDRSSLRQTVVRLELED
EWQFRLRDEFQTANAREDRPLFFLTGRHI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4ZG55	1.000	1.000	0.000	1949	1.000	1.000	Q4ZG55.pdb.gz	GREB1_HUMAN Protein GREB1 OS=Homo sapiens OX=9606 GN=GREB1 PE=2 SV=1
2	AFDB:Q5CZU6	0.207	0.958	1.570E-60	410	0.153	0.727	Q5CZU6.pdb.gz
3	AFDB:Q54Q16	0.086	0.088	9.021E-3	1917	0.068	0.069	Q54Q16.pdb.gz	Q54Q16_DICDI Chromo domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284171 PE=4 SV=1
4	PDB:7bkpA	0.102	0.241	3.231E-2	689	0.024	0.067	7bkpA.pdb.gz	MDA5 disease variant M854K prevents ATP-dependent structural discrimination of viral and cellular RNA.
5	AFDB:P12252	0.048	0.070	3.789E-2	1070	0.075	0.137	P12252.pdb.gz	PDE4B_DROME cAMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila melanogaster OX=7227 GN=dnc PE=1 SV=4
6	PDB:5vheA	0.092	0.171	3.967E-2	871	0.024	0.054	5vheA.pdb.gz	Structural basis of G-quadruplex unfolding by the DEAH/RHA helicase DHX36.
7	PDB:6pxuB	0.079	0.254	5.125E-2	532	0.016	0.060	6pxuB.pdb.gz	The structure of the colorectal cancer-associated enzyme GalNAc-T12 reveals how nonconserved residues dictate its function.
8	PDB:7r7jB	0.088	0.219	5.977E-2	574	0.026	0.089	7r7jB.pdb.gz	X-ray crystal structure of the Escherichia coli RadD DNA repair protein bound to ADP reveals a novel zinc ribbon domain.
9	PDB:5yzgZ	0.078	0.167	9.006E-2	635	0.025	0.077	5yzgZ.pdb.gz	Structure of a human catalytic step I spliceosome
10	PDB:7w0dA	0.083	0.100	9.006E-2	1544	0.032	0.040	7w0dA.pdb.gz	Structural insights into dsRNA processing by Drosophila Dicer-2-Loqs-PD.
11	PDB:7ln6F	0.060	0.133	9.978E-2	714	0.025	0.067	7ln6F.pdb.gz	Mechanistic insight into substrate processing and allosteric inhibition of human p97.
12	PDB:5ylzW	0.084	0.179	1.050E-1	703	0.025	0.070	5ylzW.pdb.gz	Structure of the Post-catalytic Spliceosome from Saccharomyces cerevisiae
13	PDB:7dcpx	0.102	0.239	1.050E-1	670	0.026	0.076	7dcpx.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
14	PDB:6iwqA	0.070	0.221	1.106E-1	546	0.013	0.048	6iwqA.pdb.gz	Structural basis of carbohydrate transfer activity of UDP-GalNAc: Polypeptide N-acetylgalactosaminyltransferase 7.
15	AFDB:Q6JPI3	0.055	0.051	5.444E-1	2207	0.105	0.093	Q6JPI3.pdb.gz	MD13L_MOUSE Mediator of RNA polymerase II transcription subunit 13-like OS=Mus musculus OX=10090 GN=Med13l PE=1 SV=2
16	AFDB:Q9XTP7	0.029	0.061	5.730E-1	719	0.034	0.092	Q9XTP7.pdb.gz	Q9XTP7_DROME DOMINA protein OS=Drosophila melanogaster OX=7227 GN=jumu PE=2 SV=1
17	AFDB:Q08AM8	0.028	0.057	8.203E-1	729	0.028	0.074	Q08AM8.pdb.gz	Q08AM8_HUMAN SH3 domain containing ring finger 2 OS=Homo sapiens OX=9606 GN=SH3RF2 PE=1 SV=1
18	AFDB:Q498M5	0.025	0.047	8.203E-1	735	0.027	0.071	Q498M5.pdb.gz	SH3R2_RAT E3 ubiquitin-protein ligase SH3RF2 OS=Rattus norvegicus OX=10116 GN=Sh3rf2 PE=1 SV=1
19	AFDB:Q6FRV6	0.033	0.030	8.634E-1	2238	0.081	0.071	Q6FRV6.pdb.gz	SEC16_CANGA COPII coat assembly protein SEC16 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SEC16 PE=3 SV=1
20	AFDB:F4HW65	0.069	0.105	1.116	1116	0.068	0.118	F4HW65.pdb.gz	STIL1_ARATH Protein STICHEL-like 1 OS=Arabidopsis thaliana OX=3702 GN=At1g14460 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B8JKP6	0.0	845	1942	0.263	0.264	GRB1L_DANRE GREB1-like protein OS=Danio rerio OX=7955 GN=greb1l PE=1 SV=2
2	B9EJV3	0.0	952	1913	0.284	0.289	GRB1L_MOUSE GREB1-like protein OS=Mus musculus OX=10090 GN=Greb1l PE=2 SV=1
3	F1QAG4	0.0	1068	1840	0.256	0.271	F1QAG4_DANRE Growth-regulating estrogen receptor-binding 1 OS=Danio rerio OX=7955 GN=greb1 PE=1 SV=2
4	Q4ZG55	0.0	4035	1949	1.000	1.000	GREB1_HUMAN Protein GREB1 OS=Homo sapiens OX=9606 GN=GREB1 PE=2 SV=1
5	Q9C091	0.0	1869	1923	0.517	0.524	GRB1L_HUMAN GREB1-like protein OS=Homo sapiens OX=9606 GN=GREB1L PE=1 SV=2
6	P35251	0.030	42.0	1148	0.017	0.030	RFC1_HUMAN Replication factor C subunit 1 OS=Homo sapiens OX=9606 GN=RFC1 PE=1 SV=4
7	Q9NCL8	2.0	35.0	264	0.025	0.186	PITP1_DICDI Phosphatidylinositol transfer protein 1 OS=Dictyostelium discoideum OX=44689 GN=pitA PE=1 SV=1
8	Q96JF0	3.0	35.0	529	0.014	0.051	SIAT2_HUMAN Beta-galactoside alpha-2,6-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST6GAL2 PE=1 SV=2
9	Q388W4	4.5	34.7	1013	0.014	0.027	Q388W4_TRYB2 Glutathione gamma-glutamylcysteinyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.0720 PE=4 SV=1
10	Q9CQM9	5.8	33.9	337	0.007	0.042	GLRX3_MOUSE Glutaredoxin-3 OS=Mus musculus OX=10090 GN=Glrx3 PE=1 SV=1
11	Q9JLZ1	6.3	33.9	337	0.007	0.042	GLRX3_RAT Glutaredoxin-3 OS=Rattus norvegicus OX=10116 GN=Glrx3 PE=1 SV=2
12	Q6K8D9	7.8	33.9	607	0.017	0.056	SKIPA_ORYSJ SNW/SKI-interacting protein A OS=Oryza sativa subsp. japonica OX=39947 GN=SKIPA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15782 GREB1	0	1840.1	GREB1 N-terminal region
2	PF20267 GREB1_C	0	1360.4	GREB1 C-terminal region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370896

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000405330	0.984	Estrogen receptor
2	9606.ENSP00000379144	0.906	Trinucleotide repeat-containing gene 6A protein
3	9606.ENSP00000401946	0.906	Trinucleotide repeat-containing gene 6B protein
4	9606.ENSP00000336783	0.904	Trinucleotide repeat-containing gene 6C protein
5	9606.ENSP00000220592	0.900	Protein argonaute-2
6	9606.ENSP00000362287	0.900	Protein argonaute-3
7	9606.ENSP00000362300	0.900	Protein argonaute-1
8	9606.ENSP00000362306	0.900	Protein argonaute-4
9	9606.ENSP00000399797	0.900	Putative helicase MOV-10
10	9606.ENSP00000263253	0.865	Histone acetyltransferase p300
11	9606.ENSP00000291527	0.841	Trefoil factor 1
12	9606.ENSP00000262367	0.824	CREB-binding protein
13	9606.ENSP00000250448	0.711	Hepatocyte nuclear factor 3-alpha
14	9606.ENSP00000325120	0.705	Progesterone receptor
15	9606.ENSP00000361066	0.597	Nuclear receptor coactivator 3
16	9606.ENSP00000394485	0.594	Na(+)/H(+) exchange regulatory cofactor NHE-RF3
17	9606.ENSP00000356205	0.586	Adenosine receptor A1
18	9606.ENSP00000383063	0.585	Nuclear receptor-interacting protein 1
19	9606.ENSP00000237937	0.579	AN1-type zinc finger protein 5
20	9606.ENSP00000368464	0.575	Kinesin-like protein KIF24

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.934	heterocyclic compound binding
GO:0097159	0.927	organic cyclic compound binding
GO:0003824	0.564	catalytic activity
GO:0003676	0.527	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007275	0.868	multicellular organism development
GO:0048731	0.762	system development
GO:0048513	0.529	animal organ development
GO:0065007	0.425	biological regulation
GO:0009987	0.412	cellular process
GO:0050794	0.330	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0031982	0.996	vesicle
GO:0005615	0.995	extracellular space
GO:0070062	0.991	extracellular exosome
GO:0005829	0.924	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]