StarFunc result for job id Q4ZHG4

User Input

>input (1894 residues)
MAPEAGATLRAPRRLSWAALLLLAALLPVASSAAASVDHPLKPRHVKLLSTKMGLKVTWD
PPKDATSRPVEHYNIAYGKSLKSLKYIKVNAETYSFLIEDVEPGVVYFVLLTAENHSGVS
RPVYRAESPPGGEWIEIDGFPIKGPGPFNETVTEKEVPNKPLRVRVRSSDDRLSVAWKAP
RLSGAKSPRRSRGFLLGYGESGRKMNYVPLTRDERTHEIKKLASESVYVVSLQSMNSQGR
SQPVYRAALTKRKISEEDELDVPDDISVRVMSSQSVLVSWVDPVLEKQKKVVASRQYTVR
YREKGELARWDYKQIANRRVLIENLIPDTVYEFAVRISQGERDGKWSTSVFQRTPESAPT
TAPENLNVWPVNGKPTVVAASWDALPETEGKVKEYILSYAPALKPFGAKSLTYPGDTTSA
LVDGLQPGERYLFKIRATNRRGLGPHSKAFIVAMPTTSKADVEQNTEDNGKPEKPEPSSP
SPRAPASSQHPSVPASPQGRNAKDLLLDLKNKILANGGAPRKPQLRAKKAEELDLQSTEI
TGEEELGSREDSPMSPSDTQDQKRTLRPPSRHGHSVVAPGRTAVRARMPALPRREGVDKP
GFSLATQPRPGAPPSASASPAHHASTQGTSHRPSLPASLNDNDLVDSDEDERAVGSLHPK
GAFAQPRPALSPSRQSPSSVLRDRSSVHPGAKPASPARRTPHSGAAEEDSSASAPPSRLS
PPHGGSSRLLPTQPHLSSPLSKGGKDGEDAPATNSNAPSRSTMSSSVSSHLSSRTQVSEG
AEASDGESHGDGDREDGGRQAEATAQTLRARPASGHFHLLRHKPFAANGRSPSRFSIGRG
PRLQPSSSPQSTVPSRAHPRVPSHSDSHPKLSSGIHGDEEDEKPLPATVVNDHVPSSSRQ
PISRGWEDLRRSPQRGASLHRKEPIPENPKSTGADTHPQGKYSSLASKAQDVQQSTDADT
EGHSPKAQPGSTDRHASPARPPAARSQQHPSVPRRMTPGRAPQQQPPPPVATSQHHPGPQ
SRDAGRSPSQPRLSLTQAGRPRPTSQGRSHSSSDPYTASSRGMLPTALQNQDEDAQGSYD
DDSTEVEAQDVRAPAHAARAKEAAASLPKHQQVESPTGAGAGGDHRSQRGHAASPARPSR
PGGPQSRARVPSRAAPGKSEPPSKRPLSSKSQQSVSAEDDEEEDAGFFKGGKEDLLSSSV
PKWPSSSTPRGGKDADGSLAKEEREPAIALAPRGGSLAPVKRPLPPPPGSSPRASHVPSR
LPPRSAATVSPVAGTHPWPQYTTRAPPGHFSTTPMLSLRQRMMHARFRNPLSRQPARPSY
RQGYNGRPNVEGKVLPGSNGKPNGQRIINGPQGTKWVVDLDRGLVLNAEGRYLQDSHGNP
LRIKLGGDGRTIVDLEGTPVVSPDGLPLFGQGRHGTPLANAQDKPILSLGGKPLVGLEVI
KKTTHPPTTTMQPTTTTTPLPTTTTPRPTTATTRRTTTTRRTTTRRPTTTVRTTTRTTTT
TTPTPTTPIPTCPPGTLERHDDDGNLIMSSNGIPECYAEEDEFSGLETDTAVPTEEAYVI
YDEDYEFETSRPPTTTEPSTTATTPRVIPEEGAISSFPEEEFDLAGRKRFVAPYVTYLNK
DPSAPCSLTDALDHFQVDSLDEIIPNDLKKSDLPPQHAPRNITVVAVEGCHSFVIVDWDK
ATPGDVVTGYLVYSASYEDFIRNKWSTQASSVTHLPIENLKPNTRYYFKVQAQNPHGYGP
ISPSVSFVTESDNPLLVVRPPGGEPIWIPFAFKHDPSYTDCHGRQYVKRTWYRKFVGVVL
CNSLRYKIYLSDNLKDTFYSIGDSWGRGEDHCQFVDSHLDGRTGPQSYVEALPTIQGYYR
QYRQEPVRFGNIGFGTPYYYVGWYECGVSIPGKW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2Q0I9	0.245	0.257	0.000	1779	0.679	0.723	Q2Q0I9.pdb.gz	FNDC1_RAT Fibronectin type III domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Fndc1 PE=1 SV=2
2	AFDB:Q4ZHG4	1.000	1.000	0.000	1894	1.000	1.000	Q4ZHG4.pdb.gz	FNDC1_HUMAN Fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FNDC1 PE=2 SV=4
3	AFDB:A0A338P6S8	0.156	0.180	1.627E-49	1637	0.216	0.250	A0A338P6S8.pdb.gz	A0A338P6S8_MOUSE ABI family member 3 binding protein OS=Mus musculus OX=10090 GN=Abi3bp PE=1 SV=1
4	AFDB:F1R2D2	0.124	0.136	2.554E-27	1687	0.121	0.136	F1R2D2.pdb.gz
5	AFDB:A0A0G2JZA1	0.115	0.138	9.234E-27	1512	0.114	0.142	A0A0G2JZA1.pdb.gz	A0A0G2JZA1_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=2
6	AFDB:O55005	0.127	0.142	1.268E-25	1651	0.114	0.131	O55005.pdb.gz	ROBO1_RAT Roundabout homolog 1 OS=Rattus norvegicus OX=10116 GN=Robo1 PE=1 SV=1
7	AFDB:Q9VZT8	0.083	0.107	9.189E-20	1443	0.108	0.141	Q9VZT8.pdb.gz	Q9VZT8_DROME Myomesin and myosin binding protein OS=Drosophila melanogaster OX=7227 GN=MnM PE=4 SV=3
8	AFDB:Q967D7	0.055	0.063	3.227E-18	1531	0.097	0.120	Q967D7.pdb.gz	TUTL_DROME Protein turtle OS=Drosophila melanogaster OX=7227 GN=tutl PE=1 SV=2
9	AFDB:D3ZB51	0.093	0.119	1.897E-15	1328	0.098	0.139	D3ZB51.pdb.gz	TUTLB_RAT Protein turtle homolog B OS=Rattus norvegicus OX=10116 GN=Igsf9b PE=1 SV=1
10	AFDB:Q9N415	0.083	0.106	1.124E-14	1276	0.107	0.159	Q9N415.pdb.gz	Q9N415_CAEEL Variant SH3 domain protein OS=Caenorhabditis elegans OX=6239 GN=rimb-1 PE=1 SV=3
11	PDB:6pxvA	0.087	0.183	1.466E-14	823	0.031	0.070	6pxvA.pdb.gz
12	PDB:8eyyA	0.086	0.191	4.569E-14	775	0.030	0.074	8eyyA.pdb.gz
13	PDB:8dtlA	0.084	0.197	2.013E-13	741	0.033	0.085	8dtlA.pdb.gz
14	PDB:6pyhD	0.084	0.181	2.159E-12	798	0.034	0.081	6pyhD.pdb.gz
15	PDB:5oj2B	0.080	0.167	7.155E-9	692	0.029	0.079	5oj2B.pdb.gz
16	PDB:7u7nC	0.063	0.413	1.295E-8	200	0.020	0.185	7u7nC.pdb.gz
17	PDB:7q5zA	0.063	0.083	8.062E-8	1344	0.028	0.039	7q5zA.pdb.gz
18	PDB:7q1yA	0.067	0.081	1.778E-7	1374	0.025	0.034	7q1yA.pdb.gz
19	PDB:1e07A	0.063	0.151	3.921E-7	642	0.025	0.073	1e07A.pdb.gz
20	PDB:4rtdA	0.061	0.092	5.822E-7	1122	0.029	0.049	4rtdA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	J3KNQ2	0.0	2937	1790	0.799	0.846	J3KNQ2_HUMAN Fibronectin type III domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=FNDC1 PE=1 SV=1
2	Q2Q0I9	0.0	1456	1779	0.467	0.497	FNDC1_RAT Fibronectin type III domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Fndc1 PE=1 SV=2
3	Q4ZHG4	0.0	3832	1894	1.000	1.000	FNDC1_HUMAN Fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FNDC1 PE=2 SV=4
4	Q8R0M1	5.06e-91	305	438	0.084	0.363	Q8R0M1_MOUSE Abi3bp protein (Fragment) OS=Mus musculus OX=10090 GN=Abi3bp PE=2 SV=1
5	F1M0R2	2.23e-86	311	1174	0.083	0.135	F1M0R2_RAT ABI family member 3 binding protein OS=Rattus norvegicus OX=10116 GN=Abi3bp PE=1 SV=4
6	Q7Z7G0	1.88e-85	307	1068	0.083	0.148	TARSH_HUMAN Target of Nesh-SH3 OS=Homo sapiens OX=9606 GN=ABI3BP PE=1 SV=2
7	A0A0R4IIB3	3.98e-36	152	1409	0.063	0.084	A0A0R4IIB3_DANRE Neogenin 1a OS=Danio rerio OX=7955 GN=cb333 PE=3 SV=2
8	A0A0R4IP15	1.21e-34	148	1428	0.065	0.087	A0A0R4IP15_DANRE Neogenin 1a OS=Danio rerio OX=7955 GN=cb333 PE=1 SV=1
9	Q94538	5.79e-34	145	1526	0.050	0.062	Q94538_DROME Frazzled OS=Drosophila melanogaster OX=7227 GN=fra PE=1 SV=1
10	A1Z920	5.93e-34	145	1526	0.050	0.062	A1Z920_DROME FI24025p1 OS=Drosophila melanogaster OX=7227 GN=fra PE=1 SV=1
11	A0A0B4LEX6	6.06e-34	145	1517	0.050	0.063	A0A0B4LEX6_DROME Frazzled, isoform C OS=Drosophila melanogaster OX=7227 GN=fra PE=1 SV=1
12	A1Z921	6.39e-34	145	1375	0.050	0.069	A1Z921_DROME Frazzled, isoform B OS=Drosophila melanogaster OX=7227 GN=fra PE=1 SV=1
13	Q94537	7.13e-34	145	1375	0.050	0.069	Q94537_DROME Frazzled OS=Drosophila melanogaster OX=7227 GN=fra PE=2 SV=1
14	Q59FP8	9.37e-34	144	1130	0.057	0.096	Q59FP8_HUMAN Neogenin 1 (Fragment) OS=Homo sapiens OX=9606 GN=NEO1 PE=1 SV=1
15	Q92859	7.71e-33	142	1461	0.061	0.079	NEO1_HUMAN Neogenin OS=Homo sapiens OX=9606 GN=NEO1 PE=1 SV=2
16	P43146	9.69e-33	142	1447	0.062	0.081	DCC_HUMAN Netrin receptor DCC OS=Homo sapiens OX=9606 GN=DCC PE=1 SV=2
17	Q63155	1.58e-32	141	1445	0.061	0.080	DCC_RAT Netrin receptor DCC OS=Rattus norvegicus OX=10116 GN=Dcc PE=1 SV=2
18	P70211	2.44e-32	140	1447	0.060	0.079	DCC_MOUSE Netrin receptor DCC OS=Mus musculus OX=10090 GN=Dcc PE=1 SV=2
19	P97798	3.47e-32	140	1492	0.061	0.077	NEO1_MOUSE Neogenin OS=Mus musculus OX=10090 GN=Neo1 PE=1 SV=2
20	P97603	3.96e-32	139	1377	0.061	0.084	NEO1_RAT Neogenin (Fragment) OS=Rattus norvegicus OX=10116 GN=Neo1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00041 fn3	1.7e-40	148.6	Fibronectin type III domain
2	PF09294 Interfer-bind	0.00052	31.6	Interferon-alpha/beta receptor, fibronectin type III
3	PF10179 NDNF	79	14.8	Neuron-derived neurotrophic factor, first Fn(III) domain
4	PF16656 Pur_ac_phosph_N	3.1e-08	45.5	Purple acid Phosphatase, N-terminal domain
5	PF01108 Tissue_fac	0.72	21.1	Tissue factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297267

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000347041	0.685	Fibromodulin
2	9606.ENSP00000481878	0.682	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
3	9606.ENSP00000391504	0.670	Coiled-coil domain containing 173
4	9606.ENSP00000287859	0.650	Protein odr-4 homolog
5	9606.ENSP00000334448	0.645	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
6	9606.ENSP00000349298	0.631	E3 ubiquitin-protein ligase MYLIP
7	9606.ENSP00000304408	0.618	Collagen alpha-1(III) chain
8	9606.ENSP00000364694	0.611	Asporin
9	9606.ENSP00000372160	0.584	Docking protein 6
10	9606.ENSP00000384006	0.574	Calcium-responsive transcription factor
11	9606.ENSP00000248598	0.569	Fibroleukin
12	9606.ENSP00000297562	0.568	AP-5 complex subunit zeta-1
13	9606.ENSP00000355920	0.559	Solute carrier family 22 member 2
14	9606.ENSP00000250003	0.558	Myoblast determination protein 1
15	9606.ENSP00000262593	0.558	Docking protein 5
16	9606.ENSP00000264717	0.555	Glucokinase regulatory protein
17	9606.ENSP00000360141	0.554	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
18	9606.ENSP00000217939	0.515	Matrix-remodeling-associated protein 5
19	9606.ENSP00000484656	0.511	MyoD family inhibitor domain-containing protein
20	9606.ENSP00000373575	0.510	Uncharacterized protein C6orf163

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0005518	0.834	collagen binding
GO:1901681	0.630	sulfur compound binding
GO:0008201	0.606	heparin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0048518	0.929	positive regulation of biological process
GO:0050896	0.913	response to stimulus
GO:0051716	0.871	cellular response to stimulus
GO:0048522	0.779	positive regulation of cellular process
GO:0042221	0.771	response to chemical
GO:0019222	0.656	regulation of metabolic process
GO:0010660	0.370	regulation of muscle cell apoptotic process
GO:0031323	0.343	regulation of cellular metabolic process
GO:0060255	0.300	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.998	nuclear lumen
GO:0005654	0.981	nucleoplasm
GO:0016604	0.955	nuclear body
GO:0005737	0.938	cytoplasm
GO:0016607	0.924	nuclear speck
GO:0071944	0.870	cell periphery
GO:0005576	0.858	extracellular region
GO:0016020	0.823	membrane
GO:0005886	0.322	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]