StarFunc result for job id Q4ZIN3

User Input

>input (620 residues)
MSEHVEPAAPGPGPNGGGGGPAPARGPRTPNLNPNPLINVRDRLFHALFFKMAVTYSRLF
PPAFRRLFEFFVLLKALFVLFVLAYIHIVFSRSPINCLEHVRDKWPREGILRVEVRHNSS
RAPVFLQFCDSGGRGSFPGLAVEPGSNLDMEDEEEEELTMEMFGNSSIKFELDIEPKVFK
PPSSTEALNDSQEFPFPETPTKVWPQDEYIVEYSLEYGFLRLSQATRQRLSIPVMVVTLD
PTRDQCFGDRFSRLLLDEFLGYDDILMSSVKGLAENEENKGFLRNVVSGEHYRFVSMWMA
RTSYLAAFAIMVIFTLSVSMLLRYSHHQIFVFIVDLLQMLEMNMAIAFPAAPLLTVILAL
VGMEAIMSEFFNDTTTAFYIILIVWLADQYDAICCHTSTSKRHWLRFFYLYHFAFYAYHY
RFNGQYSSLALVTSWLFIQHSMIYFFHHYELPAILQQVRIQEMLLQAPPLGPGTPTALPD
DMNNNSGAPATAPDSAGQPPALGPVSPGASGSPGPVAAAPSSLVAAAASVAAAAGGDLGW
MAETAAIITDASFLSGLSASLLERRPASPLGPAGGLPHAPQDSVPPSDSAASDTTPLGAA
VGGPSPASMAPTEAPSEVGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7K4L9	0.550	0.360	3.162E-38	960	0.439	0.283	Q7K4L9.pdb.gz	Q7K4L9_DROME LD33689p OS=Drosophila melanogaster OX=7227 GN=R5_2R:11947059..11948303 PE=1 SV=1
2	AFDB:Q9VFW6	0.066	0.068	7.966E-3	599	0.087	0.090	Q9VFW6.pdb.gz	Q9VFW6_DROME Pyrokinin 2 receptor 2, isoform A OS=Drosophila melanogaster OX=7227 GN=PK2-R2 PE=3 SV=2
3	AFDB:E9QEH6	0.077	0.049	9.518E-2	1245	0.094	0.047	E9QEH6.pdb.gz	E9QEH6_DANRE Sterol regulatory element-binding protein cleavage-activating protein OS=Danio rerio OX=7955 GN=scap PE=1 SV=1
4	AFDB:Q86RL0	0.059	0.072	1.161E-1	471	0.053	0.070	Q86RL0.pdb.gz	Q86RL0_DROME Thyrotropin-releasing hormone receptor OS=Drosophila melanogaster OX=7227 GN=ETHR PE=2 SV=1
5	AFDB:Q9QXZ9	0.091	0.102	1.416E-1	521	0.106	0.127	Q9QXZ9.pdb.gz	OPN4_MOUSE Melanopsin OS=Mus musculus OX=10090 GN=Opn4 PE=1 SV=1
6	AFDB:Q9TX43	0.121	0.155	1.643E-1	443	0.053	0.074	Q9TX43.pdb.gz	CAR4_DICDI Cyclic AMP receptor 4 OS=Dictyostelium discoideum OX=44689 GN=carD PE=2 SV=2
7	AFDB:Q9VFW5	0.072	0.068	1.726E-1	660	0.071	0.067	Q9VFW5.pdb.gz	Q9VFW5_DROME Pyrokinin 2 receptor 1 OS=Drosophila melanogaster OX=7227 GN=PK2-R1 PE=3 SV=1
8	AFDB:B4DJX4	0.099	0.069	2.003E-1	977	0.108	0.069	B4DJX4.pdb.gz	B4DJX4_HUMAN Pleckstrin homology domain containing A5 (Fragment) OS=Homo sapiens OX=9606 GN=PLEKHA5 PE=1 SV=1
9	AFDB:Q05471	0.069	0.035	2.443E-1	1514	0.108	0.044	Q05471.pdb.gz	SWR1_YEAST Helicase SWR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SWR1 PE=1 SV=1
10	AFDB:Q12770	0.082	0.053	2.567E-1	1279	0.095	0.046	Q12770.pdb.gz	SCAP_HUMAN Sterol regulatory element-binding protein cleavage-activating protein OS=Homo sapiens OX=9606 GN=SCAP PE=1 SV=4
11	PDB:6tqeA	0.086	0.085	7.074E-1	634	0.042	0.041	6tqeA.pdb.gz	A mycobacterial ABC transporter mediates the uptake of hydrophilic compounds.
12	PDB:4jrzA	0.097	0.246	8.627E-1	155	0.029	0.116	4jrzA.pdb.gz	Crystal Structures of Leukotriene C4 Synthase in Complex with Product Analogs: IMPLICATIONS FOR THE ENZYME MECHANISM.
13	PDB:6osaR	0.059	0.093	9.527E-1	321	0.032	0.062	6osaR.pdb.gz	Conformational transitions of a neurotensin receptor 1-Gi1complex.
14	PDB:6c6lH	0.079	0.189	1.162	160	0.042	0.163	6c6lH.pdb.gz
15	PDB:4ntaA	0.092	0.227	1.283	147	0.034	0.143	4ntaA.pdb.gz
16	PDB:6ibbA	0.066	0.100	1.283	301	0.056	0.116	6ibbA.pdb.gz	Structural basis of species-selective antagonist binding to the succinate receptor.
17	PDB:7x9yR	0.070	0.121	1.283	293	0.027	0.058	7x9yR.pdb.gz
18	PDB:5zugA	0.092	0.223	1.417	182	0.035	0.121	5zugA.pdb.gz
19	PDB:7y5xB	0.139	0.283	2.107	211	0.045	0.133	7y5xB.pdb.gz	Molecular basis for isoform-selective inhibition of presenilin-1 by MRK-560.
20	PDB:4cadI	0.070	0.129	2.214	254	0.039	0.094	4cadI.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8CIV2	0.0	933	574	0.773	0.834	MBRL_MOUSE Membralin OS=Mus musculus OX=10090 GN=Tmem259 PE=1 SV=2
2	Q7K4L9	6.53e-157	477	960	0.390	0.252	Q7K4L9_DROME LD33689p OS=Drosophila melanogaster OX=7227 GN=R5_2R:11947059..11948303 PE=1 SV=1
3	Q8GWG6	6.02e-25	112	623	0.119	0.119	MBRL_ARATH Membralin-like protein At1g60995 OS=Arabidopsis thaliana OX=3702 GN=At1g60995 PE=2 SV=1
4	Q9Y6V0	0.13	38.1	5142	0.074	0.009	PCLO_HUMAN Protein piccolo OS=Homo sapiens OX=9606 GN=PCLO PE=1 SV=5
5	Q5MJS3	0.82	35.0	579	0.056	0.060	FA20C_MOUSE Extracellular serine/threonine protein kinase FAM20C OS=Mus musculus OX=10090 GN=Fam20c PE=1 SV=1
6	E9Q7X7	0.85	35.4	1710	0.040	0.015	NRX2A_MOUSE Neurexin-2 OS=Mus musculus OX=10090 GN=Nrxn2 PE=1 SV=1
7	P13595	0.94	35.0	1115	0.068	0.038	NCAM1_MOUSE Neural cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Ncam1 PE=1 SV=3
8	M9NCR4	1.1	35.0	15105	0.069	0.003	M9NCR4_DROME Dumpy, isoform J OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
9	M9NER8	1.1	35.0	15638	0.069	0.003	M9NER8_DROME Dumpy, isoform I OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
10	M9PB32	1.1	35.0	19560	0.069	0.002	M9PB32_DROME Dumpy, isoform AA OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
11	M9PBZ4	1.1	35.0	18014	0.069	0.002	M9PBZ4_DROME Dumpy, isoform W OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
12	M9PCJ8	1.1	35.0	14825	0.069	0.003	M9PCJ8_DROME Dumpy, isoform X OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
13	B1WBN7	1.2	34.7	579	0.065	0.069	B1WBN7_RAT FAM20C OS=Rattus norvegicus OX=10116 GN=Fam20c PE=2 SV=1
14	M9PBZ0	1.6	34.7	22830	0.069	0.002	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
15	A0A8I5ZV45	1.7	34.3	650	0.065	0.062	A0A8I5ZV45_RAT FAM20C, golgi associated secretory pathway kinase OS=Rattus norvegicus OX=10116 GN=Fam20c PE=3 SV=1
16	M9PB30	1.7	34.3	22949	0.069	0.002	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
17	M9PC41	1.7	34.7	22743	0.069	0.002	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
18	M9PC45	1.7	34.3	22300	0.069	0.002	M9PC45_DROME Dumpy, isoform T OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
19	M9PEH5	1.7	34.3	20710	0.069	0.002	M9PEH5_DROME Dumpy, isoform P OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
20	M9PEI1	1.7	34.3	21657	0.069	0.002	M9PEI1_DROME Dumpy, isoform U OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09746 Membralin	2.5e-158	538.9	Tumour-associated protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349087

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000325612	0.833	Mediator of RNA polymerase II transcription subunit 16
2	9606.ENSP00000234389	0.818	Glutamate receptor ionotropic, NMDA 3B
3	9606.ENSP00000352962	0.799	Lipid phosphate phosphatase-related protein type 3
4	9606.ENSP00000476117	0.752	WD repeat-containing protein 18
5	9606.ENSP00000325836	0.733	GTP-binding protein Di-Ras1
6	9606.ENSP00000263620	0.715	AT-rich interactive domain-containing protein 3A
7	9606.ENSP00000276461	0.616	Erlin-2
8	9606.ENSP00000483688	0.614	Proteasome subunit beta type-3
9	9606.ENSP00000349428	0.561	Polypyrimidine tract-binding protein 1
10	9606.ENSP00000012443	0.539	Serine/threonine-protein phosphatase 5
11	9606.ENSP00000340811	0.537	Gap junction beta-5 protein
12	9606.ENSP00000215631	0.526	Growth arrest and DNA damage-inducible protein GADD45 beta
13	9606.ENSP00000355385	0.519	R3H domain containing 4
14	9606.ENSP00000255108	0.502	2-(3-amino-3-carboxypropyl)histidine synthase subunit 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0048518	0.977	positive regulation of biological process
GO:0051716	0.972	cellular response to stimulus
GO:0060255	0.969	regulation of macromolecule metabolic process
GO:0080090	0.965	regulation of primary metabolic process
GO:0051171	0.960	regulation of nitrogen compound metabolic process
GO:0034976	0.959	response to endoplasmic reticulum stress
GO:0051246	0.910	regulation of protein metabolic process
GO:0030162	0.888	regulation of proteolysis
GO:0009893	0.805	positive regulation of metabolic process
GO:0048522	0.775	positive regulation of cellular process
GO:0048583	0.707	regulation of response to stimulus
GO:0051173	0.580	positive regulation of nitrogen compound metabolic process
GO:0010604	0.576	positive regulation of macromolecule metabolic process
GO:0048584	0.530	positive regulation of response to stimulus
GO:0048523	0.502	negative regulation of cellular process
GO:0051247	0.464	positive regulation of protein metabolic process
GO:1903050	0.457	regulation of proteolysis involved in protein catabolic process
GO:1905897	0.456	regulation of response to endoplasmic reticulum stress
GO:0009896	0.456	positive regulation of catabolic process
GO:0045732	0.450	positive regulation of protein catabolic process
GO:1903052	0.449	positive regulation of proteolysis involved in protein catabolic process
GO:1905898	0.425	positive regulation of response to endoplasmic reticulum stress
GO:0071704	0.317	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0016020	0.811	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]