StarFunc result for job id Q502W6

User Input

>input (1294 residues)
MEKSGPSSTISEQQLQRQEGWINTKTDLAEQSLISSEKWLQLHGLKSNKLTLKQILSQIG
FPHCEDYVASLGRPVASRYADGLFPQLYRAEDGRVYNLTAKSELIYQFVEHLTQAVESYK
QRMDWLTSKSRQIFGVILEQCVTIVLDFGGILEGELDLCREALTMVLQEQVAHITEFNII
RVSQEPVKWQENATPVTEQSIATAISWVEKLTVELTVSEAGRLDALLEAGRDKTIESIYY
FVVGDVPEESKELLLQRALEIPCPVYTVSFNARGEGTIAFLKDLSAKTHSRFHAFAERTE
CVEFPAFSTKDGDNVMTWNSRKLKGKLPPGAGVREDVFLVWQEMEEACSTLAQIQRLVAE
PPKPDVATVDCESETTSVEIASNPEDTWDSKTWLQKYGLKAQKLSLYDVLADCSFRHADG
VVDIKAKPENESVQTSAETNKKTVHAKYCSRFVHAPWKDGSLVHVNITKEKCKWYSERIH
TALARIRRRIKWLQDGSQSLFGRLHNDCIYILIDTSHSMKSKLDLVKDKIIQFIQEQLKY
KSKFNFVKFDGQAVAWREQLAEVNEDNLEQAQSWIRDIKIGSSTNTLSALKTAFADKETQ
AIYLLTDGRPDQPPETVIDQVKRFQEIPIYTISFNYNDEIANRFLKEVAALTGGEFHFYN
FGCKDPTPPEAVQNEDLTLLVKEMEQGHSDLEKMQDLYSESLIMDWWYNAEKDGDSKHQK
EICSMISTPEKCAKPQSDVDSTQTSSLNMLKGPWGLSDQKVQKKKVLHAESTKTSLLRSQ
MSSLRSSACSERKDGLSNASSRRTALSDKEMSILLAEEWLDDKSSEKVTREGSQVYDHDS
SDVSSENWLKTYGLVAKKLTLMDALSVAAVPHSSTYVPVLDKHVVSKVFDEVFPLAHVCN
DTNKMTLINPQGAKLNIYKRKVEQAIQSYEKRLNKIVWRALSQEEKEKLDANKPIQYLEN
KTVLNQALERLNWPISLKELSMLESEILAGKMYIQQAMELQEAAKKNYANKAPGEQQKLQ
GNPTKKTKSKRPDPLKGQKVIARCDENGFYFPGVVKKCVSRTQALVGFSYGDTKVVSTSF
ITPVGGAMPCPLLQVGDYVFAKIVIPKGFDFYVPAIVIALPNKHVATEKFYTVLKCNNRR
EFCPRSALIKISQNKYALSCSHIKSPPIPEDPEVEDVEARNSAFLFWPLKEADTQDSREP
RREKPRRKKRPAKQPLQQAAPSDSDGSSHGISSHGSCQGTHPEPRTAHLHFPAAGRLGLS
SHAIIATPPPRAALPCTLQATHSSKGLRSVPETL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q502W6	0.999	0.999	0.000	1294	1.000	1.000	Q502W6.pdb.gz	VWA3B_HUMAN von Willebrand factor A domain-containing protein 3B OS=Homo sapiens OX=9606 GN=VWA3B PE=1 SV=3
2	PDB:7zs96	0.118	0.349	1.505E-6	383	0.021	0.070	7zs96.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
3	AFDB:Q54LJ4	0.115	0.061	6.834E-6	2563	0.102	0.052	Q54LJ4.pdb.gz	Q54LJ4_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0286613 PE=3 SV=1
4	PDB:6jp8F	0.110	0.145	1.002E-5	973	0.022	0.029	6jp8F.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
5	PDB:6gym6	0.103	0.359	1.449E-5	335	0.022	0.087	6gym6.pdb.gz	Promoter Distortion and Opening in the RNA Polymerase II Cleft.
6	PDB:3mp8A	0.078	0.181	2.727E-5	513	0.026	0.064	3mp8A.pdb.gz	Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
7	PDB:7ad8D	0.099	0.396	2.727E-5	280	0.022	0.100	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
8	PDB:2xwbF	0.102	0.178	1.072E-4	714	0.028	0.050	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.
9	PDB:4nehA	0.104	0.123	1.471E-4	1084	0.021	0.025	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
10	PDB:4nenA	0.102	0.123	1.471E-4	1063	0.022	0.026	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
11	AFDB:O14647	0.062	0.048	1.698E-4	1828	0.115	0.082	O14647.pdb.gz	CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens OX=9606 GN=CHD2 PE=1 SV=2
12	PDB:6zgaB	0.102	0.158	1.914E-4	786	0.026	0.042	6zgaB.pdb.gz	Structure of the complete, membrane-assembled COPII coat reveals a complex interaction network.
13	PDB:7ena2	0.108	0.331	2.491E-4	385	0.023	0.078	7ena2.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
14	AFDB:Q7KU24	0.063	0.046	2.728E-4	1883	0.103	0.071	Q7KU24.pdb.gz	CHD1_DROME Chromodomain-helicase-DNA-binding protein 1 OS=Drosophila melanogaster OX=7227 GN=Chd1 PE=1 SV=1
15	AFDB:Q12888	0.071	0.049	2.875E-4	1972	0.032	0.021	Q12888.pdb.gz	TP53B_HUMAN TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2
16	AFDB:Q9ZVT1	0.077	0.142	3.741E-4	670	0.026	0.049	Q9ZVT1.pdb.gz	DUF1_ARATH DUF724 domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=DUF1 PE=2 SV=1
17	AFDB:Q924A2	0.078	0.042	4.868E-4	2510	0.042	0.022	Q924A2.pdb.gz	CIC_MOUSE Protein capicua homolog OS=Mus musculus OX=10090 GN=Cic PE=1 SV=2
18	AFDB:Q8NFW1	0.107	0.086	5.132E-4	1626	0.029	0.023	Q8NFW1.pdb.gz	COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens OX=9606 GN=COL22A1 PE=2 SV=2
19	AFDB:F1Q6M9	0.079	0.041	5.409E-4	2623	0.074	0.037	F1Q6M9.pdb.gz	F1Q6M9_DANRE Capicua transcriptional repressor b OS=Danio rerio OX=7955 GN=cicb PE=4 SV=2
20	AFDB:A1X283	0.052	0.066	2.127E-3	911	0.028	0.040	A1X283.pdb.gz	SPD2B_HUMAN SH3 and PX domain-containing protein 2B OS=Homo sapiens OX=9606 GN=SH3PXD2B PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0YEM4	0.0	1364	723	0.506	0.906	H0YEM4_HUMAN von Willebrand factor A domain containing 3B (Fragment) OS=Homo sapiens OX=9606 GN=VWA3B PE=1 SV=1
2	Q502W6	0.0	2691	1294	1.000	1.000	VWA3B_HUMAN von Willebrand factor A domain-containing protein 3B OS=Homo sapiens OX=9606 GN=VWA3B PE=1 SV=3
3	A6X935	3.21e-06	54.3	942	0.032	0.044	ITIH4_MOUSE Inter alpha-trypsin inhibitor, heavy chain 4 OS=Mus musculus OX=10090 GN=Itih4 PE=1 SV=2
4	Q06033	3.30e-06	54.3	890	0.032	0.046	ITIH3_HUMAN Inter-alpha-trypsin inhibitor heavy chain H3 OS=Homo sapiens OX=9606 GN=ITIH3 PE=1 SV=2
5	Q63416	1.99e-05	51.6	887	0.032	0.046	ITIH3_RAT Inter-alpha-trypsin inhibitor heavy chain H3 OS=Rattus norvegicus OX=10116 GN=Itih3 PE=2 SV=1
6	O35802	4.63e-05	50.4	932	0.027	0.038	O35802_RAT Inter-alpha-inhibitor H4 heavy chain OS=Rattus norvegicus OX=10116 GN=Itih4 PE=2 SV=1
7	Q5EBC0	5.49e-05	50.1	933	0.027	0.038	Q5EBC0_RAT Inter-alpha-trypsin inhibitor heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Itih4 PE=4 SV=1
8	D3ZFC6	6.27e-05	50.1	927	0.027	0.038	D3ZFC6_RAT Inter-alpha-trypsin inhibitor heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Itih4 PE=1 SV=4
9	Q61704	1.59e-04	48.5	889	0.032	0.046	ITIH3_MOUSE Inter-alpha-trypsin inhibitor heavy chain H3 OS=Mus musculus OX=10090 GN=Itih3 PE=1 SV=3
10	Q14624	2.01e-04	48.1	930	0.029	0.041	ITIH4_HUMAN Inter-alpha-trypsin inhibitor heavy chain H4 OS=Homo sapiens OX=9606 GN=ITIH4 PE=1 SV=4
11	P19827	4.00e-04	47.4	911	0.027	0.038	ITIH1_HUMAN Inter-alpha-trypsin inhibitor heavy chain H1 OS=Homo sapiens OX=9606 GN=ITIH1 PE=1 SV=3
12	P79263	0.001	45.4	921	0.032	0.045	ITIH4_PIG Inter-alpha-trypsin inhibitor heavy chain H4 OS=Sus scrofa OX=9823 GN=ITIH4 PE=1 SV=1
13	Q86UX2	0.001	45.4	942	0.019	0.027	ITIH5_HUMAN Inter-alpha-trypsin inhibitor heavy chain H5 OS=Homo sapiens OX=9606 GN=ITIH5 PE=2 SV=2
14	Q3T052	0.005	43.9	916	0.028	0.039	ITIH4_BOVIN Inter-alpha-trypsin inhibitor heavy chain H4 OS=Bos taurus OX=9913 GN=ITIH4 PE=1 SV=1
15	Q8BJD1	0.005	43.9	952	0.019	0.025	ITIH5_MOUSE Inter-alpha-trypsin inhibitor heavy chain H5 OS=Mus musculus OX=10090 GN=Itih5 PE=1 SV=1
16	Q61702	0.10	39.3	907	0.028	0.040	ITIH1_MOUSE Inter-alpha-trypsin inhibitor heavy chain H1 OS=Mus musculus OX=10090 GN=Itih1 PE=1 SV=2
17	Q8L798	3.7	34.3	754	0.020	0.034	Q8L798_ARATH Inter-alpha-trypsin inhibitor heavy chain-like protein OS=Arabidopsis thaliana OX=3702 GN=At1g19110 PE=1 SV=1
18	A8WFZ2	5.3	33.5	507	0.016	0.041	A8WFZ2_DANRE Nuclear pore glycoprotein p62 OS=Danio rerio OX=7955 GN=fb13d02 PE=1 SV=1
19	E9QIQ3	5.5	33.5	507	0.016	0.041	E9QIQ3_DANRE Nuclear pore glycoprotein p62 isoform X1 OS=Danio rerio OX=7955 GN=fb13d02 PE=1 SV=2
20	P03303	8.3	33.5	2179	0.036	0.021	POLG_HRV14 Genome polyprotein OS=Human rhinovirus 14 OX=12131 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15057 DUF4537	1.6e-30	117.0	Domain of unknown function (DUF4537)
2	PF00092 VWA	4.9e-09	48.2	von Willebrand factor type A domain
3	PF13519 VWA_2	0.00041	32.3	von Willebrand factor type A domain
4	PF13768 VWA_3	5.2e-19	80.2	von Willebrand factor type A domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000417955

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000429896	0.570	Protein FAM178B
2	9606.ENSP00000410470	0.561	Fumarylacetoacetate hydrolase domain-containing protein 2B
3	9606.ENSP00000233379	0.524	Fumarylacetoacetate hydrolase domain-containing protein 2A
4	9606.ENSP00000297866	0.524	Cilia- and flagella-associated protein 47
5	9606.ENSP00000367926	0.524	Cilia- and flagella-associated protein 47
6	9606.ENSP00000367929	0.524	Cilia- and flagella-associated protein 47
7	9606.ENSP00000295208	0.517	Zinc finger protein 514
8	9606.ENSP00000355121	0.507	Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1
9	9606.ENSP00000418751	0.507	BTB/POZ domain-containing protein 9
10	9606.ENSP00000377170	0.505	Ankyrin repeat domain-containing protein 39

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.955	biological regulation
GO:0009987	0.948	cellular process
GO:0050789	0.830	regulation of biological process
GO:0050794	0.800	regulation of cellular process
GO:0050896	0.536	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0016020	0.864	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]