StarFunc result for job id Q504Q3

User Input

>input (1202 residues)
MNFEGLDPGLAEYAPAMHSALDPVLDAHLNPSLLQNVELDPEGVALEALPVQESVHIMEG
VYSELHSVVAEVGVPVSVSHFDLHEEMLWVGSHGGHATSFFGPALERYSSFQVNGSDDIR
QIQSLENGILFLTKNNLKYMARGGLIIFDYLLDENEDMHSLLLTDSSTLLVGGLQNHIIE
IDLNTVQETQKYAVETPGVTIMRQTNRFFFCGHTSGKVSLRDLRTFKVEHEFDAFSGSLS
DFDVHGNLLAACGFSSRLTGLACDRFLKVYDLRMMRAITPLQVHVDPAFLRFIPTYTSRL
AIISQSGQCQFCEPTGLANPADIFHVNPVGPLLMTFDVSASKQALAFGDSEGCVHLWTDS
PEPSFNPYSRETEFALPCLVDSLPPLDWSQDLLPLSLIPVPLTTDTLLSDWPAANSAPAP
RRAPPVDAEILRTMKKVGFIGYAPNPRTRLRNQIPYRLKESDSEFDSFSQVTESPVGREE
EPHLHMVSKKYRKVTIKYSKLGLEDFDFKHYNKTLFAGLEPHIPNAYCNCMIQVLYFLEP
VRCLIQNHLCQKEFCLACELGFLFHMLDLSRGDPCQGNNFLRAFRTIPEASALGLILADS
DEASGKGNLARLIQRWNRFILTQLHQDMQELEIPQAYRGAGGSSFCSSGDSVIGQLFSCE
MENCSLCRCGSETVRASSTLLFTLSYPDGSKSDKTGKNYDFAQVLKRSICLDQNTQAWCD
TCEKYQPTIQTRNIRHLPDILVINCEVNSSKEADFWRMQAEVAFKMAVKKHGGEISKNKE
FALADWKELGSPEGVLVCPSIEELKNVWLPFSIRMKMTKNKGLDVCNWTDGDEMQWGPAR
AEEEHGVYVYDLMATVVHILDSRTGGSLVAHIKVGETYHQRKEGVTHQQWYLFNDFLIEP
IDKHEAVQFDMNWKVPAILYYVKRNLNSRYNLNIKNPIEASVLLAEASLARKQRKTHTTF
IPLMLNEMPQIGDLVGLDAEFVTLNEEEAELRSDGTKSTIKPSQMSVARITCVRGQGPNE
GIPFIDDYISTQEQVVDYLTQYSGIKPGDLDAKISSKHLTTLKSTYLKLRFLIDIGVKFV
GHGLQKDFRVINLMVPKDQVLDTVYLFHMPRKRMISLRFLAWYFLDLKIQGETHDSIEDA
RTALQLYRKYLELSKNGTEPESFHKVLKGLYEKGRKMDWKVPEPEGQTSPKNAAVFSSVL
AL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A1Z7K9	0.513	0.498	0.000	1241	0.423	0.410	A1Z7K9.pdb.gz	PAN2_DROME PAN2-PAN3 deadenylation complex catalytic subunit PAN2 OS=Drosophila melanogaster OX=7227 GN=PAN2 PE=1 SV=1
2	AFDB:Q504Q3	1.000	1.000	0.000	1202	1.000	1.000	Q504Q3.pdb.gz	PAN2_HUMAN PAN2-PAN3 deadenylation complex catalytic subunit PAN2 OS=Homo sapiens OX=9606 GN=PAN2 PE=1 SV=3
3	AFDB:G0SAK8	0.496	0.509	2.148E-98	1170	0.290	0.297	G0SAK8.pdb.gz	PAN2_CHATD PAN2-PAN3 deadenylation complex catalytic subunit PAN2 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=PAN2 PE=1 SV=1
4	AFDB:Q09798	0.494	0.542	5.174E-97	1088	0.300	0.331	Q09798.pdb.gz	PAN2_SCHPO PAN2-PAN3 deadenylation complex catalytic subunit pan2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pan2 PE=3 SV=2
5	AFDB:P0C581	0.483	0.444	9.734E-91	1310	0.282	0.259	P0C581.pdb.gz	PAN2_NEUCR PAN2-PAN3 deadenylation complex catalytic subunit pan2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=par-1 PE=1 SV=2
6	AFDB:P53015	0.428	0.453	6.306E-82	1131	0.245	0.260	P53015.pdb.gz	YPO4_CAEEL Uncharacterized protein F31E3.4 OS=Caenorhabditis elegans OX=6239 GN=F31E3.4 PE=4 SV=1
7	AFDB:P53010	0.464	0.498	9.930E-80	1115	0.236	0.255	P53010.pdb.gz	PAN2_YEAST PAN2-PAN3 deadenylation complex catalytic subunit PAN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PAN2 PE=1 SV=1
8	PDB:6r5kA	0.446	0.510	1.182E-60	1040	0.232	0.268	6r5kA.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
9	AFDB:Q6NLV4	0.229	0.414	1.662E-17	647	0.060	0.111	Q6NLV4.pdb.gz	FY_ARATH Flowering time control protein FY OS=Arabidopsis thaliana OX=3702 GN=FY PE=1 SV=1
10	AFDB:F4K3Y7	0.226	0.403	1.845E-17	657	0.054	0.099	F4K3Y7.pdb.gz	F4K3Y7_ARATH Transducin/WD40 repeat-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=FY PE=1 SV=2
11	AFDB:P87053	0.214	0.410	2.157E-17	605	0.052	0.104	P87053.pdb.gz	POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pof1 PE=1 SV=1
12	PDB:6ttuT	0.211	0.606	4.679E-15	394	0.027	0.081	6ttuT.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
13	PDB:5yzgs	0.221	0.671	4.930E-15	374	0.035	0.112	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
14	PDB:3zwlD	0.207	0.646	7.102E-15	352	0.038	0.131	3zwlD.pdb.gz
15	PDB:5cvnB	0.211	0.710	1.023E-14	321	0.059	0.221	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
16	PDB:7mq8LW	0.208	0.521	2.124E-14	453	0.038	0.102	7mq8LW.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:5mzhB	0.212	0.566	5.720E-14	415	0.041	0.118	5mzhB.pdb.gz
18	PDB:5o9zL	0.212	0.519	6.689E-14	459	0.027	0.072	5o9zL.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
19	PDB:7w3ax	0.200	0.452	7.425E-14	494	0.054	0.132	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
20	PDB:7zgrD	0.223	0.641	7.425E-14	395	0.032	0.099	7zgrD.pdb.gz	Mpe1 senses the binding of pre-mRNA and controls 3' end processing by CPF.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1Z7K9	0.0	899	1241	0.419	0.406	PAN2_DROME PAN2-PAN3 deadenylation complex catalytic subunit PAN2 OS=Drosophila melanogaster OX=7227 GN=PAN2 PE=1 SV=1
2	Q504Q3	0.0	2507	1202	1.000	1.000	PAN2_HUMAN PAN2-PAN3 deadenylation complex catalytic subunit PAN2 OS=Homo sapiens OX=9606 GN=PAN2 PE=1 SV=3
3	Q8BGF7	0.0	2387	1200	0.961	0.963	PAN2_MOUSE PAN2-PAN3 deadenylation complex catalytic subunit Pan2 OS=Mus musculus OX=10090 GN=Pan2 PE=1 SV=1
4	Q8SWW0	0.0	679	930	0.327	0.423	Q8SWW0_DROME LD37466p OS=Drosophila melanogaster OX=7227 GN=PAN2 PE=2 SV=1
5	G0SAK8	1.10e-166	528	1170	0.300	0.308	PAN2_CHATD PAN2-PAN3 deadenylation complex catalytic subunit PAN2 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=PAN2 PE=1 SV=1
6	Q09798	1.60e-161	511	1088	0.305	0.337	PAN2_SCHPO PAN2-PAN3 deadenylation complex catalytic subunit pan2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pan2 PE=3 SV=2
7	Q8MRI7	4.19e-160	494	658	0.215	0.394	Q8MRI7_DROME LD22095p OS=Drosophila melanogaster OX=7227 GN=PAN2 PE=2 SV=1
8	P0C581	4.18e-154	498	1310	0.290	0.266	PAN2_NEUCR PAN2-PAN3 deadenylation complex catalytic subunit pan2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=par-1 PE=1 SV=2
9	P53015	4.13e-110	374	1131	0.271	0.288	YPO4_CAEEL Uncharacterized protein F31E3.4 OS=Caenorhabditis elegans OX=6239 GN=F31E3.4 PE=4 SV=1
10	P53010	5.95e-60	227	1115	0.106	0.115	PAN2_YEAST PAN2-PAN3 deadenylation complex catalytic subunit PAN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PAN2 PE=1 SV=1
11	Q08237	1.83e-12	71.6	289	0.050	0.208	REXO4_YEAST RNA exonuclease 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=REX4 PE=1 SV=1
12	Q580Z1	3.85e-12	73.2	789	0.045	0.068	Q580Z1_TRYB2 Exonuclease domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10J17.670 PE=4 SV=1
13	Q96IC2	4.66e-11	69.7	774	0.038	0.059	REXO5_HUMAN RNA exonuclease 5 OS=Homo sapiens OX=9606 GN=REXO5 PE=2 SV=1
14	Q9GZR2	1.39e-10	67.4	422	0.054	0.154	REXO4_HUMAN RNA exonuclease 4 OS=Homo sapiens OX=9606 GN=REXO4 PE=1 SV=2
15	P53331	7.79e-10	65.5	553	0.038	0.083	REXO1_YEAST RNA exonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RNH70 PE=1 SV=1
16	Q54EC1	1.98e-09	64.3	694	0.044	0.076	Q54EC1_DICDI RNA exonuclease 1 OS=Dictyostelium discoideum OX=44689 GN=rexo1 PE=4 SV=1
17	Q8WTP8	1.49e-08	60.1	325	0.033	0.123	AEN_HUMAN Apoptosis-enhancing nuclease OS=Homo sapiens OX=9606 GN=AEN PE=1 SV=2
18	Q9P7H2	1.86e-08	60.8	540	0.040	0.089	REXO3_SCHPO RNA exonuclease 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rex3 PE=3 SV=1
19	Q9VRX7	2.13e-07	57.8	681	0.036	0.063	Q9VRX7_DROME LD29573p OS=Drosophila melanogaster OX=7227 GN=Rexo5 PE=1 SV=1
20	Q8RXK2	2.33e-07	57.8	782	0.030	0.046	SDN3_ARATH Small RNA degrading nuclease 3 OS=Arabidopsis thaliana OX=3702 GN=SDN3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00929 RNase_T	4.3e-16	71.4	Exonuclease
2	PF00443 UCH	4.8e-07	41.1	Ubiquitin carboxyl-terminal hydrolase
3	PF13423 UCH_1	2.5e-99	344.5	Ubiquitin carboxyl-terminal hydrolase
4	PF17005 WD40_like	0.078	23.9	WD40-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000401721

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370345	0.999	PAN2-PAN3 deadenylation complex subunit PAN3
2	9606.ENSP00000313007	0.985	Polyadenylate-binding protein 1
3	9606.ENSP00000416255	0.919	Eukaryotic translation initiation factor 4 gamma 1
4	9606.ENSP00000293831	0.914	Eukaryotic initiation factor 4A-I
5	9606.ENSP00000326381	0.914	Eukaryotic initiation factor 4A-II
6	9606.ENSP00000302768	0.912	Polyadenylate-binding protein-interacting protein 1
7	9606.ENSP00000269349	0.910	Eukaryotic initiation factor 4A-III
8	9606.ENSP00000336783	0.907	Trinucleotide repeat-containing gene 6C protein
9	9606.ENSP00000388806	0.907	Eukaryotic translation initiation factor 4B
10	9606.ENSP00000425561	0.906	Eukaryotic translation initiation factor 4E
11	9606.ENSP00000377024	0.729	CCR4-NOT transcription complex subunit 6
12	9606.ENSP00000320949	0.703	CCR4-NOT transcription complex subunit 1
13	9606.ENSP00000424896	0.689	CCR4-NOT transcription complex subunit 6-like
14	9606.ENSP00000384863	0.650	Exportin-1
15	9606.ENSP00000433146	0.646	Ubiquitin carboxyl-terminal hydrolase 47
16	9606.ENSP00000264951	0.629	5'-3' exoribonuclease 1
17	9606.ENSP00000355929	0.617	Angel homolog 2
18	9606.ENSP00000361162	0.615	Target of EGR1 protein 1
19	9606.ENSP00000376007	0.610	Poly(A)-specific ribonuclease PNLDC1
20	9606.ENSP00000310596	0.599	U6 snRNA-associated Sm-like protein LSm1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016787	0.999	hydrolase activity
GO:0004527	0.985	exonuclease activity
GO:0000175	0.977	3'-5'-RNA exonuclease activity
GO:0004535	0.926	poly(A)-specific ribonuclease activity
GO:0003676	0.625	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0044238	0.989	primary metabolic process
GO:0006807	0.988	nitrogen compound metabolic process
GO:0051248	0.988	negative regulation of protein metabolic process
GO:0010558	0.987	negative regulation of macromolecule biosynthetic process
GO:0031327	0.986	negative regulation of cellular biosynthetic process
GO:0043170	0.985	macromolecule metabolic process
GO:0006417	0.985	regulation of translation
GO:0000289	0.982	nuclear-transcribed mRNA poly(A) tail shortening

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	0.996	intracellular organelle
GO:0032991	0.994	protein-containing complex
GO:0005829	0.990	cytosol
GO:0043232	0.990	intracellular non-membrane-bounded organelle
GO:0005634	0.886	nucleus
GO:0070013	0.540	intracellular organelle lumen
GO:0099080	0.511	supramolecular complex
GO:0035770	0.486	ribonucleoprotein granule
GO:0036464	0.469	cytoplasmic ribonucleoprotein granule
GO:0031251	0.393	PAN complex
GO:0031981	0.331	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.999	Hydrolases.
EC:3.1.-.-	0.985	Acting on ester bonds.
EC:3.1.13.-	0.977	Exoribonucleases producing 5'-phosphomonoesters.
EC:3.1.13.4	0.926	poly(A)-specific ribonuclease.

[back to server]