StarFunc result for job id Q504T8

User Input

>input (468 residues)
MEPQPGGARSCRRGAPGGACELGPAAEAAPMSLAIHSTTGTRYDLAVPPDETVEGLRKRL
SQRLKVPKERLALLHKDTRLSSGKLQEFGVGDGSKLTLVPTVEAGLMSQASRPEQSVMQA
LESLTETQVSDFLSGRSPLTLALRVGDHMMFVQLQLAAQHAPLQHRHVLAAAAAAAAARG
DPSIASPVSSPCRPVSSAARVPPVPTSPSPASPSPITAGSFRSHAASTTCPEQMDCSPTA
SSSASPGASTTSTPGASPAPRSRKPGAVIESFVNHAPGVFSGTFSGTLHPNCQDSSGRPR
RDIGTILQILNDLLSATRHYQGMPPSLAQLRCHAQCSPASPAPDLAPRTTSCEKLTAAPS
ASLLQGQSQIRMCKPPGDRLRQTENRATRCKVERLQLLLQQKRLRRKARRDARGPYHWSP
SRKAGRSDSSSSGGGGSPSEASGLGLDFEDSVWKPEVNPDIKSEFVVA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q504T8	1.000	1.000	1.930E-78	468	1.000	1.000	Q504T8.pdb.gz	MIDN_HUMAN Midnolin OS=Homo sapiens OX=9606 GN=MIDN PE=1 SV=2
2	AFDB:D4AE48	0.696	0.651	2.403E-66	505	0.919	0.851	D4AE48.pdb.gz	MIDN_RAT Midnolin OS=Rattus norvegicus OX=10116 GN=Midn PE=1 SV=1
3	PDB:3plvA	0.152	0.809	8.015E-6	80	0.030	0.175	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
4	PDB:3dbhI	0.163	0.790	9.029E-6	86	0.034	0.186	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
5	PDB:3ai5A	0.150	0.233	1.216E-5	299	0.036	0.057	3ai5A.pdb.gz
6	PDB:7rbsB	0.158	0.453	1.637E-5	157	0.034	0.102	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
7	PDB:6yvaC	0.150	0.440	1.844E-5	155	0.053	0.161	6yvaC.pdb.gz
8	PDB:4pyuA	0.150	0.854	2.204E-5	76	0.026	0.158	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
9	PDB:6mdhA	0.144	0.438	7.691E-5	149	0.024	0.074	6mdhA.pdb.gz
10	PDB:5xqmA	0.145	0.685	1.036E-4	90	0.026	0.133	5xqmA.pdb.gz
11	PDB:6ef3u	0.151	0.867	1.993E-4	75	0.032	0.200	6ef3u.pdb.gz	Substrate-engaged 26Sproteasome structures reveal mechanisms for ATP-hydrolysis-driven translocation.
12	AFDB:O42967	0.151	0.118	2.873E-4	603	0.135	0.104	O42967.pdb.gz	YB92_SCHPO Uncharacterized ubiquitin-like protein C1E8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1E8.02 PE=1 SV=1
13	PDB:6rpqA	0.154	0.279	3.614E-4	249	0.041	0.076	6rpqA.pdb.gz
14	AFDB:E7F568	0.152	0.058	5.869E-4	1343	0.165	0.057	E7F568.pdb.gz	COBL_DANRE Protein cordon-bleu OS=Danio rerio OX=7955 GN=cobl PE=1 SV=2
15	AFDB:O09130	0.156	0.177	9.621E-3	412	0.043	0.049	O09130.pdb.gz	NF2IP_MOUSE NFATC2-interacting protein OS=Mus musculus OX=10090 GN=Nfatc2ip PE=1 SV=1
16	AFDB:D3ZUI5	0.158	0.068	1.150E-2	1133	0.124	0.051	D3ZUI5.pdb.gz	COBL_RAT Protein cordon-bleu OS=Rattus norvegicus OX=10116 GN=Cobl PE=1 SV=1
17	AFDB:G1SU30	0.156	0.065	1.459E-2	1162	0.152	0.061	G1SU30.pdb.gz	G1SU30_RABIT Large proline-rich protein BAG6 OS=Oryctolagus cuniculus OX=9986 GN=BAG6 PE=4 SV=2
18	AFDB:A2A761	0.079	0.066	2.349E-2	587	0.103	0.082	A2A761.pdb.gz	ZFP69_MOUSE Zinc finger protein 69 OS=Mus musculus OX=10090 GN=Zfp69 PE=3 SV=1
19	AFDB:Q53SF7	0.158	0.069	4.259E-2	1128	0.139	0.058	Q53SF7.pdb.gz	COBL1_HUMAN Cordon-bleu protein-like 1 OS=Homo sapiens OX=9606 GN=COBLL1 PE=1 SV=3
20	AFDB:Q62728	0.155	0.068	4.259E-2	1175	0.160	0.064	Q62728.pdb.gz	PTN21_RAT Tyrosine-protein phosphatase non-receptor type 21 OS=Rattus norvegicus OX=10116 GN=Ptpn21 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4AE48	0.0	711	505	0.915	0.848	MIDN_RAT Midnolin OS=Rattus norvegicus OX=10116 GN=Midn PE=1 SV=1
2	Q3TPJ7	0.0	723	465	0.904	0.910	MIDN_MOUSE Midnolin OS=Mus musculus OX=10090 GN=Midn PE=2 SV=1
3	Q504T8	0.0	933	468	1.000	1.000	MIDN_HUMAN Midnolin OS=Homo sapiens OX=9606 GN=MIDN PE=1 SV=2
4	Q8SXD4	1.74e-32	133	1122	0.145	0.061	MIDN_DROME Midnolin homolog OS=Drosophila melanogaster OX=7227 GN=stx PE=1 SV=1
5	B7NZQ9	2.33e-05	46.6	157	0.058	0.172	UBL4A_RABIT Ubiquitin-like protein 4A OS=Oryctolagus cuniculus OX=9986 GN=UBL4A PE=3 SV=1
6	Q5HY81	6.71e-05	45.8	180	0.058	0.150	Q5HY81_HUMAN Ubiquitin-like protein 4A OS=Homo sapiens OX=9606 GN=UBL4A PE=1 SV=2
7	P11441	7.52e-05	45.4	157	0.058	0.172	UBL4A_HUMAN Ubiquitin-like protein 4A OS=Homo sapiens OX=9606 GN=UBL4A PE=1 SV=1
8	O97267	0.001	43.9	2114	0.053	0.012	O97267_PLAF7 Circumsporozoite- and TRAP-related protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0315200 PE=4 SV=1
9	Q8N7F7	0.061	37.0	174	0.053	0.144	UBL4B_HUMAN Ubiquitin-like protein 4B OS=Homo sapiens OX=9606 GN=UBL4B PE=1 SV=1
10	Q386A3	0.14	37.0	620	0.047	0.035	Q386A3_TRYB2 Ubiquitin-like protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1600 PE=4 SV=1
11	Q9QZM0	2.4	33.1	638	0.036	0.027	UBQL2_MOUSE Ubiquilin-2 OS=Mus musculus OX=10090 GN=Ubqln2 PE=1 SV=2
12	O94537	2.6	33.1	1072	0.041	0.018	IRE1_SCHPO Sensor for unfolded proteins in the ER ire1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ire1 PE=1 SV=1
13	B4UN33	4.4	32.3	1423	0.073	0.024	B4UN33_CANGA Candida glabrata strain CBS138 chromosome K complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0K00170g PE=4 SV=1
14	Q92353	8.9	31.2	468	0.034	0.034	UBP6_SCHPO Ubiquitin carboxyl-terminal hydrolase 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp6 PE=1 SV=2
15	R9PY16	9.1	30.8	301	0.038	0.060	R9PY16_DROME Ubiquitin-like domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Ubi-p5E5 PE=4 SV=1
16	P87050	9.3	31.2	775	0.060	0.036	CDR2_SCHPO Mitosis inducer protein kinase cdr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdr2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11976 Rad60-SLD	1.4e+02	13.7	Ubiquitin-2 like Rad60 SUMO-like
2	PF00240 ubiquitin	0.011	26.8	Ubiquitin family
3	PF08817 YukD	1.2e+02	14.9	WXG100 protein secretion system (Wss), protein YukD

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000300952

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000457703	0.668	Ubiquitin-like protein 7
2	9606.ENSP00000386557	0.654	Uncharacterized membrane protein C19orf24
3	9606.ENSP00000358674	0.622	Ubiquitin-like protein 4A
4	9606.ENSP00000465260	0.602	Voltage-dependent calcium channel beta subunit-associated regulatory protein
5	9606.ENSP00000354733	0.565	Protein strawberry notch homolog 2
6	9606.ENSP00000355385	0.519	R3H domain containing 4
7	9606.ENSP00000328677	0.507	C2 calcium-dependent domain-containing protein 4C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.982	biological regulation
GO:0048523	0.973	negative regulation of cellular process
GO:0065008	0.970	regulation of biological quality
GO:0031323	0.968	regulation of cellular metabolic process
GO:0051046	0.964	regulation of secretion
GO:0051224	0.955	negative regulation of protein transport
GO:0080090	0.953	regulation of primary metabolic process
GO:0031324	0.933	negative regulation of cellular metabolic process
GO:0023051	0.918	regulation of signaling
GO:0010646	0.918	regulation of cell communication
GO:1903530	0.911	regulation of secretion by cell
GO:0010817	0.898	regulation of hormone levels
GO:0051048	0.895	negative regulation of secretion
GO:0051174	0.887	regulation of phosphorus metabolic process
GO:0006109	0.872	regulation of carbohydrate metabolic process
GO:1903531	0.872	negative regulation of secretion by cell
GO:0010563	0.869	negative regulation of phosphorus metabolic process
GO:0065009	0.855	regulation of molecular function
GO:0062012	0.852	regulation of small molecule metabolic process
GO:0090087	0.849	regulation of peptide transport
GO:0023057	0.849	negative regulation of signaling
GO:0045912	0.846	negative regulation of carbohydrate metabolic process
GO:0051338	0.841	regulation of transferase activity
GO:0019220	0.828	regulation of phosphate metabolic process
GO:0050708	0.821	regulation of protein secretion
GO:0045936	0.816	negative regulation of phosphate metabolic process
GO:0010648	0.758	negative regulation of cell communication
GO:0010675	0.748	regulation of cellular carbohydrate metabolic process
GO:0009987	0.722	cellular process
GO:0050709	0.679	negative regulation of protein secretion
GO:0044092	0.650	negative regulation of molecular function
GO:0010677	0.646	negative regulation of cellular carbohydrate metabolic process
GO:0008152	0.522	metabolic process
GO:0071704	0.463	organic substance metabolic process
GO:0043549	0.460	regulation of kinase activity
GO:0033673	0.438	negative regulation of kinase activity
GO:0090278	0.436	negative regulation of peptide hormone secretion
GO:0046676	0.431	negative regulation of insulin secretion
GO:0010906	0.430	regulation of glucose metabolic process
GO:0006807	0.429	nitrogen compound metabolic process
GO:0060255	0.403	regulation of macromolecule metabolic process
GO:0051171	0.385	regulation of nitrogen compound metabolic process
GO:0044238	0.362	primary metabolic process
GO:0044237	0.302	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0031981	0.975	nuclear lumen
GO:0005829	0.974	cytosol
GO:0043232	0.844	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]