StarFunc result for job id Q504Y3

User Input

>input (356 residues)
MDKEKLDVKIEYCNYAMDSSVENMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYC
FMNTDSRYNNCSISEEDFPEESQLHQCGFKIVYSQLPLGSLVLVKLQNWPSWPGILCPDR
FKGKYVTYDPDGNVEEYHIEFLGDPHSRSWIKATFVGHYSITLKPEKCKNKKKWYKSALQ
EACLLYGYSHEQRLEMCCLSKLQDKSETHDKVAALVKKRKQTSKNNIEKKKPKFRKRKRK
AILKCSFENVYSDDALSKENRVVCETEVLLKELEQMLQQALQPTATPDESEEGHGEEINM
GEKLSKCSPEAPAGSLFENHYEEDYLVIDGIKLKAGECIEDITNKFKEIDALMSEF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q504Y3	1.000	1.000	9.933E-65	356	1.000	1.000	Q504Y3.pdb.gz	ZCPW2_HUMAN Zinc finger CW-type PWWP domain protein 2 OS=Homo sapiens OX=9606 GN=ZCWPW2 PE=1 SV=1
2	AFDB:Q6IR42	0.306	0.180	3.357E-12	630	0.208	0.117	Q6IR42.pdb.gz	ZCPW1_MOUSE Zinc finger CW-type PWWP domain protein 1 OS=Mus musculus OX=10090 GN=Zcwpw1 PE=1 SV=2
3	AFDB:D4A0U9	0.257	0.071	2.490E-8	1362	0.112	0.029	D4A0U9.pdb.gz	D4A0U9_RAT DNA mismatch repair protein OS=Rattus norvegicus OX=10116 GN=Msh6 PE=1 SV=4
4	AFDB:P54276	0.252	0.070	4.476E-8	1358	0.112	0.029	P54276.pdb.gz	MSH6_MOUSE DNA mismatch repair protein Msh6 OS=Mus musculus OX=10090 GN=Msh6 PE=1 SV=3
5	AFDB:P52701	0.266	0.074	5.569E-7	1360	0.129	0.034	P52701.pdb.gz	MSH6_HUMAN DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6 PE=1 SV=2
6	AFDB:F4IZM8	0.232	0.068	3.674E-3	1347	0.101	0.027	F4IZM8.pdb.gz	HUAL3_ARATH Protein HUA2-LIKE 3 OS=Arabidopsis thaliana OX=3702 GN=HULK3 PE=2 SV=1
7	PDB:6s01K	0.190	0.667	1.472E-2	86	0.051	0.209	6s01K.pdb.gz	Structure of H3K36-methylated nucleosome-PWWP complex reveals multivalent cross-gyre binding.
8	AFDB:Q3LHL9	0.157	0.047	3.216E-2	1658	0.115	0.025	Q3LHL9.pdb.gz	WGE_DROME Protein winged eye OS=Drosophila melanogaster OX=7227 GN=wge PE=1 SV=1
9	PDB:6c6sD	0.131	0.274	8.058E-2	161	0.056	0.124	6c6sD.pdb.gz	Structural Basis for Transcript Elongation Control by NusG Family Universal Regulators.
10	AFDB:A0A0K3AXH1	0.131	0.033	9.238E-2	1648	0.101	0.022	A0A0K3AXH1.pdb.gz	ARID1_CAEEL AT-rich interactive domain-containing protein arid-1 OS=Caenorhabditis elegans OX=6239 GN=arid-1 PE=3 SV=1
11	PDB:3jb9D	0.103	0.284	1.146E-1	96	0.034	0.125	3jb9D.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
12	PDB:4v8mA1	0.129	0.174	1.629E-1	247	0.028	0.040	4v8mA1.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
13	PDB:7nkxZ	0.129	0.272	1.629E-1	156	0.034	0.077	7nkxZ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
14	PDB:1k9aB	0.116	0.095	1.727E-1	441	0.028	0.023	1k9aB.pdb.gz
15	PDB:3j791	0.147	0.319	1.727E-1	140	0.028	0.071	3j791.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
16	PDB:3swnQ	0.100	0.330	1.727E-1	73	0.039	0.192	3swnQ.pdb.gz	Structure of the LSm657 complex: an assembly intermediate of the LSm1-7 and LSm2-8 rings.
17	PDB:4c92G	0.115	0.333	1.942E-1	75	0.037	0.173	4c92G.pdb.gz
18	PDB:4c92B	0.099	0.254	2.059E-1	105	0.048	0.162	4c92B.pdb.gz
19	AFDB:Q86VD1	0.138	0.053	4.001E-1	984	0.135	0.049	Q86VD1.pdb.gz	MORC1_HUMAN MORC family CW-type zinc finger protein 1 OS=Homo sapiens OX=9606 GN=MORC1 PE=2 SV=2
20	AFDB:Q9Y6K1	0.170	0.078	5.687E-1	912	0.110	0.043	Q9Y6K1.pdb.gz	DNM3A_HUMAN DNA (cytosine-5)-methyltransferase 3A OS=Homo sapiens OX=9606 GN=DNMT3A PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q504Y3	0.0	736	356	1.000	1.000	ZCPW2_HUMAN Zinc finger CW-type PWWP domain protein 2 OS=Homo sapiens OX=9606 GN=ZCWPW2 PE=1 SV=1
2	Q6IR42	2.48e-16	82.4	630	0.149	0.084	ZCPW1_MOUSE Zinc finger CW-type PWWP domain protein 1 OS=Mus musculus OX=10090 GN=Zcwpw1 PE=1 SV=2
3	Q9H0M4	6.04e-15	78.2	648	0.126	0.069	ZCPW1_HUMAN Zinc finger CW-type PWWP domain protein 1 OS=Homo sapiens OX=9606 GN=ZCWPW1 PE=1 SV=2
4	A0A0S2Z6A9	1.16e-14	76.6	376	0.126	0.120	A0A0S2Z6A9_HUMAN Zinc finger CW type with PWWP domain 1 isoform 6 OS=Homo sapiens OX=9606 GN=ZCWPW1 PE=1 SV=1
5	A0A0S2Z5E1	3.15e-13	72.4	404	0.126	0.111	A0A0S2Z5E1_HUMAN Zinc finger CW type with PWWP domain 1 isoform 4 OS=Homo sapiens OX=9606 GN=ZCWPW1 PE=1 SV=1
6	Q2LAE1	3.06e-05	48.5	1759	0.062	0.013	ASHH2_ARATH Histone-lysine N-methyltransferase ASHH2 OS=Arabidopsis thaliana OX=3702 GN=ASHH2 PE=1 SV=1
7	Q803S7	8.44e-04	43.9	1369	0.073	0.019	Q803S7_DANRE DNA mismatch repair protein OS=Danio rerio OX=7955 GN=wu:fb36c12 PE=1 SV=1
8	Q8TE76	0.004	41.6	937	0.056	0.021	MORC4_HUMAN MORC family CW-type zinc finger protein 4 OS=Homo sapiens OX=9606 GN=MORC4 PE=1 SV=2
9	A0A1W2Q695	0.006	41.2	1361	0.073	0.019	A0A1W2Q695_RAT DNA mismatch repair protein OS=Rattus norvegicus OX=10116 GN=Msh6 PE=1 SV=2
10	D4A0U9	0.006	41.2	1336	0.073	0.019	D4A0U9_RAT DNA mismatch repair protein OS=Rattus norvegicus OX=10116 GN=Msh6 PE=1 SV=4
11	D6R9V2	0.026	38.5	392	0.048	0.043	D6R9V2_HUMAN Nuclear receptor binding SET domain protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=NSD2 PE=1 SV=1
12	O96028	0.030	38.9	1365	0.048	0.012	NSD2_HUMAN Histone-lysine N-methyltransferase NSD2 OS=Homo sapiens OX=9606 GN=NSD2 PE=1 SV=1
13	Q69ZX6	0.075	37.7	1030	0.051	0.017	MOR2A_MOUSE ATPase MORC2A OS=Mus musculus OX=10090 GN=Morc2a PE=1 SV=2
14	F7BJB9	0.085	37.4	942	0.053	0.020	MORC3_MOUSE MORC family CW-type zinc finger protein 3 OS=Mus musculus OX=10090 GN=Morc3 PE=1 SV=1
15	P52701	0.085	37.4	1360	0.045	0.012	MSH6_HUMAN DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6 PE=1 SV=2
16	P54276	0.11	37.0	1358	0.067	0.018	MSH6_MOUSE DNA mismatch repair protein Msh6 OS=Mus musculus OX=10090 GN=Msh6 PE=1 SV=3
17	Q8BVE8	0.12	37.0	1365	0.045	0.012	NSD2_MOUSE Histone-lysine N-methyltransferase NSD2 OS=Mus musculus OX=10090 GN=Nsd2 PE=1 SV=2
18	Q14149	0.17	36.6	939	0.062	0.023	MORC3_HUMAN MORC family CW-type zinc finger protein 3 OS=Homo sapiens OX=9606 GN=MORC3 PE=1 SV=3
19	Q96L73	0.22	36.2	2696	0.073	0.010	NSD1_HUMAN Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Homo sapiens OX=9606 GN=NSD1 PE=1 SV=1
20	Q9Y6X9	0.22	36.2	1032	0.051	0.017	MORC2_HUMAN ATPase MORC2 OS=Homo sapiens OX=9606 GN=MORC2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09320 DUF1977	4.3e+02	12.5	Domain of unknown function (DUF1977)
2	PF00855 PWWP	4e-07	41.8	PWWP domain
3	PF07496 zf-CW	4.7e-12	57.0	CW-type Zinc Finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373278

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000476960	0.810	Histone cluster 2 H3 pseudogene 2
2	9606.ENSP00000254810	0.800	H3 histone, family 3B (H3.3B)
3	9606.ENSP00000333277	0.800	Histone cluster 2 H3 family member d
4	9606.ENSP00000339835	0.800	Histone H3.3C
5	9606.ENSP00000352252	0.800	Histone cluster 1 H3 family member j
6	9606.ENSP00000355657	0.800	Histone H3.1t
7	9606.ENSP00000355778	0.800	Histone H3.3
8	9606.ENSP00000358154	0.800	Histone cluster 2 H3 family member c
9	9606.ENSP00000358160	0.800	Histone cluster 1 H3 family member h
10	9606.ENSP00000366999	0.800	Histone cluster 1 H3 family member d
11	9606.ENSP00000385479	0.800	Histone H3.2
12	9606.ENSP00000480826	0.800	Histone cluster 1 H3 family member a
13	9606.ENSP00000482271	0.800	Histone cluster 1 H3 family member e
14	9606.ENSP00000483283	0.800	Histone cluster 1 H3 family member i
15	9606.ENSP00000484095	0.800	Histone cluster 1 H3 family member f
16	9606.ENSP00000484638	0.800	Histone cluster 1 H3 family member g
17	9606.ENSP00000484658	0.800	Histone cluster 1 H3 family member c
18	9606.ENSP00000484841	0.800	Histone H3.1
19	9606.ENSP00000377428	0.547	Cilia and flagella associated protein 44

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0035064	1.000	methylated histone binding
GO:0097159	0.577	organic cyclic compound binding
GO:1901363	0.510	heterocyclic compound binding
GO:0003676	0.391	nucleic acid binding
GO:0003677	0.360	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0009987	0.987	cellular process
GO:0019222	0.987	regulation of metabolic process
GO:0050794	0.973	regulation of cellular process
GO:0060255	0.960	regulation of macromolecule metabolic process
GO:0080090	0.944	regulation of primary metabolic process
GO:0031323	0.944	regulation of cellular metabolic process
GO:0051171	0.940	regulation of nitrogen compound metabolic process
GO:0019219	0.874	regulation of nucleobase-containing compound metabolic process
GO:0008152	0.871	metabolic process
GO:0044237	0.837	cellular metabolic process
GO:0071704	0.836	organic substance metabolic process
GO:0071840	0.814	cellular component organization or biogenesis
GO:0016043	0.796	cellular component organization
GO:0044238	0.795	primary metabolic process
GO:0048518	0.756	positive regulation of biological process
GO:0048522	0.712	positive regulation of cellular process
GO:0010468	0.712	regulation of gene expression
GO:0043170	0.632	macromolecule metabolic process
GO:0009893	0.589	positive regulation of metabolic process
GO:0044260	0.529	cellular macromolecule metabolic process
GO:0006807	0.476	nitrogen compound metabolic process
GO:0010604	0.431	positive regulation of macromolecule metabolic process
GO:0006996	0.422	organelle organization
GO:0031325	0.393	positive regulation of cellular metabolic process
GO:0051173	0.346	positive regulation of nitrogen compound metabolic process
GO:0032501	0.337	multicellular organismal process
GO:0032502	0.326	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0043232	0.965	intracellular non-membrane-bounded organelle
GO:0005694	0.901	chromosome
GO:0032991	0.764	protein-containing complex
GO:0005615	0.335	extracellular space
GO:1903561	0.325	extracellular vesicle
GO:0070062	0.321	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]