StarFunc result for job id Q52LJ0

User Input

>input (433 residues)
MRGPEPGPQPTMEGDVLDTLEALGYKGPLLEEQALTKAAEGGLSSPEFSELCIWLGSQIK
SLCNLEESITSAGRDDLESFQLEISGFLKEMACPYSVLISGDIKDRLKKKEDCLKLLLFL
STELQASQILQNKKHKNSQLDKNSEVYQEVQAMFDTLGIPKSTTSDIPHMLNQVESKVKD
ILSKVQKNHVGKPLLKMDLNSEQAEQLERINDALSCEYECRRRMLMKRLDVTVQSFGWSD
RAKVKTDDIARIYQPKRYALSPKTTITMAHLLAAREDLSKIIRTSSGTSREKTACAINKV
LMGRVPDRGGRPNEIEPPPPEMPPWQKRQEGGGGRGGWGGGGGGGGRGGGGGGGGRGGWG
GGGGGWGGGGGGGGGWGGGGGGGRGGFQGRGDYGGRGGYGGRGGYGGRGYGDPYGGGGGG
GGGGGGGGGYRRY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q52LJ0	1.000	1.000	9.991E-52	433	1.000	1.000	Q52LJ0.pdb.gz	FA98B_HUMAN Protein FAM98B OS=Homo sapiens OX=9606 GN=FAM98B PE=1 SV=2
2	AFDB:Q8NCA5	0.362	0.307	1.395E-28	518	0.554	0.463	Q8NCA5.pdb.gz	FA98A_HUMAN Protein FAM98A OS=Homo sapiens OX=9606 GN=FAM98A PE=1 SV=2
3	AFDB:Q17RN3	0.363	0.443	6.688E-18	349	0.275	0.341	Q17RN3.pdb.gz	FA98C_HUMAN Protein FAM98C OS=Homo sapiens OX=9606 GN=FAM98C PE=1 SV=1
4	PDB:2ftzA	0.086	0.123	6.998E-1	265	0.092	0.151	2ftzA.pdb.gz
5	PDB:6z5lA	0.114	0.155	7.329E-1	251	0.060	0.104	6z5lA.pdb.gz
6	PDB:5iplF	0.098	0.132	9.231E-1	277	0.060	0.094	5iplF.pdb.gz	Structures of E. coli sigma S-transcription initiation complexes provide new insights into polymerase mechanism.
7	AFDB:Q57WZ2	0.193	0.177	1.093	477	0.074	0.067	Q57WZ2.pdb.gz	Q57WZ2_TRYB2 Intraflagellar transport protein A1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27F10.120 PE=3 SV=1
8	AFDB:Q96PY5	0.081	0.045	1.145	1086	0.118	0.047	Q96PY5.pdb.gz	FMNL2_HUMAN Formin-like protein 2 OS=Homo sapiens OX=9606 GN=FMNL2 PE=1 SV=3
9	AFDB:Q8NHY3	0.202	0.111	1.581	880	0.074	0.036	Q8NHY3.pdb.gz	GA2L2_HUMAN GAS2-like protein 2 OS=Homo sapiens OX=9606 GN=GAS2L2 PE=1 SV=1
10	PDB:2r6aB	0.092	0.102	1.844	374	0.042	0.048	2r6aB.pdb.gz
11	PDB:7kpvC	0.075	0.069	2.668	487	0.072	0.064	7kpvC.pdb.gz
12	PDB:3bnfA	0.105	0.097	2.926	471	0.053	0.049	3bnfA.pdb.gz	Binding and Reduction of Sulfite by Cytochrome c Nitrite Reductase
13	AFDB:B8JJL4	0.076	0.059	3.309	600	0.092	0.067	B8JJL4.pdb.gz
14	AFDB:Q9CSP9	0.093	0.056	3.309	761	0.083	0.047	Q9CSP9.pdb.gz	TTC14_MOUSE Tetratricopeptide repeat protein 14 OS=Mus musculus OX=10090 GN=Ttc14 PE=1 SV=3
15	PDB:1z7cA	0.095	0.185	3.360	161	0.042	0.112	1z7cA.pdb.gz
16	PDB:3c98B	0.092	0.160	3.519	230	0.074	0.139	3c98B.pdb.gz
17	AFDB:G5EDS1	0.099	0.096	3.800	455	0.109	0.103	G5EDS1.pdb.gz	VAB3_CAEEL Paired box protein 6 homolog OS=Caenorhabditis elegans OX=6239 GN=vab-3 PE=1 SV=1
18	PDB:4nmnA	0.081	0.082	3.859	425	0.051	0.052	4nmnA.pdb.gz	Nucleotide and partner-protein control of bacterial replicative helicase structure and function.
19	PDB:7n58A	0.115	0.086	3.859	600	0.069	0.050	7n58A.pdb.gz
20	AFDB:Q15311	0.095	0.069	4.570	655	0.106	0.070	Q15311.pdb.gz	RBP1_HUMAN RalA-binding protein 1 OS=Homo sapiens OX=9606 GN=RALBP1 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q52LJ0	0.0	853	433	1.000	1.000	FA98B_HUMAN Protein FAM98B OS=Homo sapiens OX=9606 GN=FAM98B PE=1 SV=2
2	Q8NCA5	3.94e-111	338	518	0.434	0.363	FA98A_HUMAN Protein FAM98A OS=Homo sapiens OX=9606 GN=FAM98A PE=1 SV=2
3	Q3TJZ6	2.94e-108	331	515	0.425	0.357	FA98A_MOUSE Protein FAM98A OS=Mus musculus OX=10090 GN=Fam98a PE=1 SV=1
4	Q17RN3	4.04e-57	193	349	0.286	0.355	FA98C_HUMAN Protein FAM98C OS=Homo sapiens OX=9606 GN=FAM98C PE=1 SV=1
5	A0A8I6AHL9	0.010	40.8	3316	0.085	0.011	A0A8I6AHL9_RAT Collagen type VI alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col6a3 PE=1 SV=1
6	A0A8I5ZTR6	0.011	40.8	3109	0.085	0.012	A0A8I5ZTR6_RAT Collagen type VI alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col6a3 PE=1 SV=1
7	P27692	0.012	40.4	1063	0.062	0.025	SPT5_YEAST Transcription elongation factor SPT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPT5 PE=1 SV=1
8	A0A8I6ADR1	0.019	40.0	2708	0.085	0.014	A0A8I6ADR1_RAT Collagen type VI alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col6a3 PE=1 SV=1
9	P12111	0.024	39.7	3177	0.085	0.012	CO6A3_HUMAN Collagen alpha-3(VI) chain OS=Homo sapiens OX=9606 GN=COL6A3 PE=1 SV=5
10	E9PWQ3	0.030	39.3	3284	0.083	0.011	E9PWQ3_MOUSE Collagen, type VI, alpha 3 OS=Mus musculus OX=10090 GN=Col6a3 PE=1 SV=2
11	A6H584	0.087	37.7	2640	0.090	0.015	CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus OX=10090 GN=Col6a5 PE=1 SV=4
12	Q966L9	0.097	37.7	974	0.102	0.045	GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans OX=6239 GN=glh-2 PE=1 SV=1
13	Q387F2	0.70	35.0	1553	0.079	0.022	Q387F2_TRYB2 Nucleoporin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0140 PE=4 SV=1
14	Q5K4F8	0.74	34.7	567	0.079	0.060	Q5K4F8_DANRE Prion protein 2 OS=Danio rerio OX=7955 GN=prp2 PE=2 SV=1
15	Q584T3	0.81	34.7	775	0.113	0.063	Q584T3_TRYB2 Mitochondrial oligo U binding protein TBRGG1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4M18.600 PE=4 SV=1
16	A0A087WS16	6.1	32.0	2677	0.081	0.013	A0A087WS16_MOUSE Collagen, type VI, alpha 3 OS=Mus musculus OX=10090 GN=Col6a3 PE=1 SV=1
17	J3QQ16	6.1	32.0	2677	0.081	0.013	J3QQ16_MOUSE Collagen, type VI, alpha 3 OS=Mus musculus OX=10090 GN=Col6a3 PE=1 SV=1
18	O88493	7.1	31.6	2657	0.081	0.013	O88493_MOUSE Type VI collagen alpha 3 subunit OS=Mus musculus OX=10090 GN=Col6a3 PE=2 SV=1
19	Q57Y65	8.2	31.6	1617	0.074	0.020	Q57Y65_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.15M23.280 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11388 DotA	56	15.4	Phagosome trafficking protein DotA
2	PF10239 DUF2465	6.1e-125	428.2	Protein of unknown function (DUF2465)
3	PF01988 VIT1	66	14.8	VIT family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380734

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261700	0.999	RNA transcription, translation and transport factor protein
2	9606.ENSP00000370745	0.999	ATP-dependent RNA helicase DDX1
3	9606.ENSP00000216038	0.998	tRNA-splicing ligase RtcB homolog
4	9606.ENSP00000258457	0.993	Ashwin
5	9606.ENSP00000417677	0.976	Protein archease
6	9606.ENSP00000284995	0.972	tRNA-splicing endonuclease subunit Sen2
7	9606.ENSP00000397402	0.915	tRNA-splicing endonuclease subunit Sen34
8	9606.ENSP00000355299	0.912	tRNA-splicing endonuclease subunit Sen15
9	9606.ENSP00000327487	0.907	tRNA-splicing endonuclease subunit Sen54
10	9606.ENSP00000365162	0.705	Myosin light chain kinase 2, skeletal/cardiac muscle
11	9606.ENSP00000325144	0.687	Uncharacterized protein C15orf53
12	9606.ENSP00000435289	0.680	Platelet-activating factor acetylhydrolase IB subunit beta
13	9606.ENSP00000295640	0.678	Aminopeptidase B
14	9606.ENSP00000455397	0.662	Uncharacterized protein C15orf41
15	9606.ENSP00000311677	0.661	Nuclear inhibitor of protein phosphatase 1
16	9606.ENSP00000256538	0.648	Diphthine--ammonia ligase
17	9606.ENSP00000383333	0.640	MORC family CW-type zinc finger protein 3
18	9606.ENSP00000362330	0.562	Chromodomain-helicase-DNA-binding protein 6
19	9606.ENSP00000238823	0.561	Protein FAM98A
20	9606.ENSP00000252530	0.540	Protein FAM98C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0008276	1.000	protein methyltransferase activity
GO:0042802	0.999	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0043412	0.978	macromolecule modification
GO:0048518	0.975	positive regulation of biological process
GO:0050794	0.974	regulation of cellular process
GO:0006479	0.962	protein methylation
GO:0048522	0.958	positive regulation of cellular process
GO:0019222	0.956	regulation of metabolic process
GO:0060255	0.952	regulation of macromolecule metabolic process
GO:0009893	0.926	positive regulation of metabolic process
GO:0010468	0.924	regulation of gene expression
GO:0042127	0.918	regulation of cell population proliferation
GO:0010604	0.914	positive regulation of macromolecule metabolic process
GO:0010628	0.876	positive regulation of gene expression
GO:0008284	0.847	positive regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1902494	1.000	catalytic complex
GO:0005737	1.000	cytoplasm
GO:0005654	1.000	nucleoplasm
GO:0140535	0.998	intracellular protein-containing complex
GO:0043228	0.766	non-membrane-bounded organelle
GO:0043232	0.754	intracellular non-membrane-bounded organelle
GO:0016020	0.745	membrane
GO:0072669	0.639	tRNA-splicing ligase complex
GO:0005829	0.304	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	1.000	Methyltransferases.

[back to server]