StarFunc result for job id Q52LR7

User Input

>input (807 residues)
MSKLSFRARALDAAKPLPIYRGKDMPDLNDCVSINRAVPQMPTGMEKEEESEHHLQRAIS
AQQVFREKKESMVIPVPEAESNVNYYNRLYKGEFKQPKQFIHIQPFNLDNEQPDYDMDSE
DETLLNRLNRKMEIKPLQFEIMIDRLEKASSNQLVTLQEAKLLLNEDDYLIKAVYDYWVR
KRKNCRGPSLIPQIKQEKRDGSTNNDPYVAFRRRTEKMQTRKNRKNDEASYEKMLKLRRE
FSRAITILEMIKRREKTKRELLHLTLEVVEKRYHLGDYGGEILNEVKISRSEKELYATPA
TLHNGNHHKVQECKTKHPHHLSLKEEASDVVRQKKKYPKKPKAEALITSQQPTPETLPVI
NKSDIKQYDFHSSDEDEFPQVLSPVSEPEEENDPDGPCAFRRRAGCQYYAPRLDQANHSC
ENSELADLDKLRYRHCLTTLTVPRRCIGFARRRIGRGGRVIMDRISTEHDPVLKQIDPEM
LNSFSSSSQTIDFSSNFSRTNASSKHCENRLSLSEILSNIRSCRLQCFQPRLLNLQDSDS
EECTSRKPGQTVNNKRVSAASVALLNTSKNGISVTGGITEEQFQTHQQQLVQMQRQQLAQ
LQQKQQSQHSSQQTHPKAQGSSTSDCMSKTLDSASAHFAASAVVSAPVPSRSEVAKEQNT
GHNNINGVVQPSGTSKTLYSTNMALSSSPGISAVQLVRTVGHTTTNHLIPALCTSSPQTL
PMNNSCLTNAVHLNNVSVVSPVNVHINTRTSAPSPTALKLATVAASMDRVPKVTPSSAIS
SIARENHEPERLGLNGIAETTVAMEVT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q52LR7	1.000	1.000	0.000	807	1.000	1.000	Q52LR7.pdb.gz	EPC2_HUMAN Enhancer of polycomb homolog 2 OS=Homo sapiens OX=9606 GN=EPC2 PE=1 SV=2
2	AFDB:F1RDZ9	0.461	0.491	1.372E-74	751	0.591	0.635	F1RDZ9.pdb.gz
3	AFDB:Q9H2F5	0.369	0.357	3.831E-70	836	0.560	0.541	Q9H2F5.pdb.gz	EPC1_HUMAN Enhancer of polycomb homolog 1 OS=Homo sapiens OX=9606 GN=EPC1 PE=1 SV=1
4	PDB:7vvuT	0.220	0.586	2.265E-7	274	0.074	0.219	7vvuT.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
5	AFDB:Q9DCB4	0.073	0.073	5.074E-4	807	0.156	0.156	Q9DCB4.pdb.gz	ARP21_MOUSE cAMP-regulated phosphoprotein 21 OS=Mus musculus OX=10090 GN=Arpp21 PE=1 SV=2
6	AFDB:Q8N944	0.044	0.042	4.543E-2	861	0.138	0.129	Q8N944.pdb.gz	AMER3_HUMAN APC membrane recruitment protein 3 OS=Homo sapiens OX=9606 GN=AMER3 PE=1 SV=2
7	AFDB:A6NJT0	0.050	0.067	4.835E-2	531	0.098	0.149	A6NJT0.pdb.gz	UNC4_HUMAN Homeobox protein unc-4 homolog OS=Homo sapiens OX=9606 GN=UNCX PE=3 SV=1
8	AFDB:A0A096LNW1	0.063	0.061	6.606E-2	954	0.146	0.124	A0A096LNW1.pdb.gz	A0A096LNW1_HUMAN DNA helicase (Fragment) OS=Homo sapiens OX=9606 GN=ATRX PE=1 SV=1
9	AFDB:A0A1D8PL89	0.053	0.064	6.606E-2	629	0.109	0.140	A0A1D8PL89.pdb.gz	A0A1D8PL89_CANAL Zcf21p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ZCF21 PE=4 SV=1
10	AFDB:A8E7B7	0.057	0.045	7.967E-2	1122	0.135	0.097	A8E7B7.pdb.gz
11	AFDB:Q9P242	0.076	0.088	8.480E-2	653	0.103	0.127	Q9P242.pdb.gz	NYAP2_HUMAN Neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adapter 2 OS=Homo sapiens OX=9606 GN=NYAP2 PE=1 SV=3
12	PDB:6dv9F	0.051	0.186	1.057	174	0.015	0.069	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
13	PDB:7ajtUO	0.050	0.071	1.357	493	0.020	0.032	7ajtUO.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
14	PDB:3aqcA	0.034	0.139	2.380	135	0.010	0.059	3aqcA.pdb.gz	Crystal structure of heterodimeric hexaprenyl diphosphate synthase from Micrococcus luteus B-P 26 reveals that the small subunit is directly involved in the product chain length regulation.
15	PDB:7d5tRQ	0.047	0.092	2.380	339	0.031	0.074	7d5tRQ.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state F1)
16	PDB:7d4iRQ	0.050	0.099	2.534	339	0.029	0.068	7d4iRQ.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
17	PDB:7pubFh	0.052	0.115	2.697	274	0.029	0.084	7pubFh.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
18	PDB:1bo0A	0.036	0.219	2.870	76	0.015	0.158	1bo0A.pdb.gz
19	PDB:1j8iA	0.043	0.215	2.870	93	0.015	0.129	1j8iA.pdb.gz
20	PDB:5nr5A	0.050	0.275	2.870	113	0.015	0.106	5nr5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6G2P8	0.0	704	812	0.545	0.542	A0A8I6G2P8_RAT Enhancer of polycomb homolog OS=Rattus norvegicus OX=10116 GN=Epc1 PE=3 SV=1
2	A0A8I6GEL3	0.0	614	764	0.491	0.518	A0A8I6GEL3_RAT Enhancer of polycomb homolog 1 OS=Rattus norvegicus OX=10116 GN=Epc1 PE=4 SV=1
3	D4A6E4	0.0	614	762	0.491	0.520	D4A6E4_RAT Enhancer of polycomb homolog 1 OS=Rattus norvegicus OX=10116 GN=Epc1 PE=1 SV=3
4	Q52LR7	0.0	1679	807	1.000	1.000	EPC2_HUMAN Enhancer of polycomb homolog 2 OS=Homo sapiens OX=9606 GN=EPC2 PE=1 SV=2
5	Q7ZUK6	0.0	848	751	0.596	0.640	Q7ZUK6_DANRE Enhancer of polycomb homolog OS=Danio rerio OX=7955 GN=zgc:55784 PE=2 SV=1
6	Q9H2F5	0.0	717	836	0.555	0.536	EPC1_HUMAN Enhancer of polycomb homolog 1 OS=Homo sapiens OX=9606 GN=EPC1 PE=1 SV=1
7	A0A0B4KFP2	1.27e-94	327	2097	0.198	0.076	A0A0B4KFP2_DROME Enhancer of polycomb-like protein OS=Drosophila melanogaster OX=7227 GN=E(Pc) PE=1 SV=1
8	A0A0B4KET9	1.70e-94	327	2033	0.198	0.079	A0A0B4KET9_DROME Enhancer of polycomb-like protein OS=Drosophila melanogaster OX=7227 GN=E(Pc) PE=1 SV=1
9	Q0E9C2	1.85e-94	327	2023	0.198	0.079	Q0E9C2_DROME Enhancer of polycomb-like protein OS=Drosophila melanogaster OX=7227 GN=E(Pc) PE=1 SV=1
10	O96542	2.09e-94	327	2023	0.198	0.079	O96542_DROME Enhancer of polycomb-like protein OS=Drosophila melanogaster OX=7227 GN=E(Pc) PE=2 SV=1
11	A0A0B4KEK1	2.72e-94	326	1974	0.198	0.081	A0A0B4KEK1_DROME Enhancer of polycomb-like protein OS=Drosophila melanogaster OX=7227 GN=E(Pc) PE=1 SV=1
12	Q9UU94	3.47e-23	107	557	0.166	0.241	EPL1_SCHPO Enhancer of polycomb-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=epl1 PE=3 SV=1
13	A0A8I6A414	1.44e-21	90.9	60	0.053	0.717	A0A8I6A414_RAT Enhancer of polycomb homolog 1 OS=Rattus norvegicus OX=10116 GN=Epc1 PE=4 SV=1
14	Q4KM29	5.73e-20	90.5	190	0.051	0.216	Q4KM29_RAT Epc1 protein OS=Rattus norvegicus OX=10116 GN=Epc1 PE=2 SV=1
15	P43572	2.09e-17	89.4	832	0.102	0.099	EPL1_YEAST Enhancer of polycomb-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EPL1 PE=1 SV=1
16	Q8GYQ9	2.43e-15	81.6	453	0.110	0.196	Q8GYQ9_ARATH Enhancer of polycomb-like protein OS=Arabidopsis thaliana OX=3702 GN=YUP8H12R.36 PE=1 SV=1
17	Q5AAG1	3.98e-08	59.3	753	0.066	0.070	EPL1_CANAL Enhancer of polycomb-like protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EPL1 PE=3 SV=1
18	Q7YZH1	7.19e-05	49.3	3241	0.043	0.011	RNO_DROME PHD finger protein rhinoceros OS=Drosophila melanogaster OX=7227 GN=rno PE=1 SV=1
19	Q9ULD4	0.088	38.9	1205	0.032	0.022	BRPF3_HUMAN Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens OX=9606 GN=BRPF3 PE=1 SV=2
20	O95696	0.14	38.1	1058	0.035	0.026	BRD1_HUMAN Bromodomain-containing protein 1 OS=Homo sapiens OX=9606 GN=BRD1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12253 CAF1A	3.6e+02	12.8	Chromatin assembly factor 1 subunit A
2	PF02515 CoA_transf_3	1.6e+02	12.9	CoA-transferase family III
3	PF10513 EPL1	4.3e-12	58.3	Enhancer of polycomb-like
4	PF06752 E_Pc_C	2.6e-65	232.3	Enhancer of Polycomb C-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258484

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000247843	0.994	YEATS domain-containing protein 4
2	9606.ENSP00000331310	0.993	Mortality factor 4-like protein 1
3	9606.ENSP00000359518	0.990	MRG/MORF4L-binding protein
4	9606.ENSP00000362166	0.986	Chromatin modification-related protein MEAF6
5	9606.ENSP00000352925	0.985	Transformation/transcription domain-associated protein
6	9606.ENSP00000340330	0.984	Histone acetyltransferase KAT5
7	9606.ENSP00000361363	0.970	DNA methyltransferase 1-associated protein 1
8	9606.ENSP00000394417	0.958	Mortality factor 4-like protein 2
9	9606.ENSP00000320566	0.952	Inhibitor of growth protein 3
10	9606.ENSP00000397552	0.923	Actin-like protein 6A
11	9606.ENSP00000473172	0.913	RuvB-like 2
12	9606.ENSP00000374213	0.910	E1A-binding protein p400
13	9606.ENSP00000406037	0.872	Histone acetyltransferase KAT8
14	9606.ENSP00000318297	0.862	RuvB-like 1
15	9606.ENSP00000427329	0.862	Forkhead box R2
16	9606.ENSP00000160382	0.856	Actin-like protein 6B
17	9606.ENSP00000352173	0.846	Placenta-specific protein 1
18	9606.ENSP00000322142	0.822	Inhibitor of growth protein 5
19	9606.ENSP00000380024	0.822	Inhibitor of growth protein 4
20	9606.ENSP00000385247	0.813	Calpain-14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140463	0.893	chromatin-protein adaptor activity
GO:0140767	0.880	enzyme-substrate adaptor activity
GO:0003824	0.545	catalytic activity
GO:0016740	0.520	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.989	organic substance metabolic process
GO:0050794	0.986	regulation of cellular process
GO:0044238	0.981	primary metabolic process
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0006807	0.973	nitrogen compound metabolic process
GO:0048522	0.971	positive regulation of cellular process
GO:0019219	0.967	regulation of nucleobase-containing compound metabolic process
GO:0009987	0.953	cellular process
GO:0043170	0.952	macromolecule metabolic process
GO:0010569	0.949	regulation of double-strand break repair via homologous recombination
GO:0051054	0.928	positive regulation of DNA metabolic process
GO:0045911	0.915	positive regulation of DNA recombination
GO:0043967	0.907	histone H4 acetylation
GO:2000781	0.880	positive regulation of double-strand break repair
GO:0051726	0.856	regulation of cell cycle
GO:0010468	0.563	regulation of gene expression
GO:0009889	0.385	regulation of biosynthetic process
GO:0071840	0.383	cellular component organization or biogenesis
GO:0051252	0.379	regulation of RNA metabolic process
GO:0010556	0.378	regulation of macromolecule biosynthetic process
GO:0031326	0.378	regulation of cellular biosynthetic process
GO:0050896	0.364	response to stimulus
GO:0016043	0.352	cellular component organization
GO:0032502	0.341	developmental process
GO:2001141	0.325	regulation of RNA biosynthetic process
GO:0032501	0.320	multicellular organismal process
GO:0006355	0.318	regulation of DNA-templated transcription
GO:0044237	0.309	cellular metabolic process
GO:0048519	0.303	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0035267	1.000	NuA4 histone acetyltransferase complex
GO:0000786	0.996	nucleosome
GO:0043231	0.971	intracellular membrane-bounded organelle
GO:0070013	0.969	intracellular organelle lumen
GO:0031981	0.955	nuclear lumen
GO:0005654	0.952	nucleoplasm
GO:0005737	0.619	cytoplasm
GO:0016020	0.370	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.520	Transferases.

[back to server]