StarFunc result for job id Q53EL6

User Input

>input (469 residues)
MDVENEQILNVNPADPDNLSDSLFSGDEENAGTEEIKNEINGNWISASSINEARINAKAK
RRLRKNSSRDSGRGDSVSDSGSDALRSGLTVPTSPKGRLLDRRSRSGKGRGLPKKGGAGG
KGVWGTPGQVYDVEEVDVKDPNYDDDQENCVYETVVLPLDERAFEKTLTPIIQEYFEHGD
TNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTDVEKSF
DKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATV
LLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFH
HELVYEAIIMVLESTGESTFKMILDLLKSLWKSSTITVDQMKRGYERIYNEIPDINLDVP
HSYSVLERFVEECFQAGIISKQLRDLCPSRGRKRFVSEGDGGRLKPESY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q53EL6	1.000	1.000	5.115E-58	469	1.000	1.000	Q53EL6.pdb.gz	PDCD4_HUMAN Programmed cell death protein 4 OS=Homo sapiens OX=9606 GN=PDCD4 PE=1 SV=2
2	AFDB:Q98TX3	0.726	0.728	5.436E-49	467	0.844	0.848	Q98TX3.pdb.gz	PDCD4_CHICK Programmed cell death protein 4 OS=Gallus gallus OX=9031 GN=PDCD4 PE=2 SV=1
3	AFDB:Q1L8Y5	0.749	0.748	1.029E-42	470	0.693	0.691	Q1L8Y5.pdb.gz	Q1L8Y5_DANRE Programmed cell death protein 4 OS=Danio rerio OX=7955 GN=pdcd4-2 PE=1 SV=1
4	AFDB:Q9VY91	0.628	0.580	1.278E-25	509	0.384	0.354	Q9VY91.pdb.gz	Q9VY91_DROME Programmed cell death protein 4 OS=Drosophila melanogaster OX=7227 GN=Pdcd4 PE=1 SV=2
5	AFDB:Q94BR1	0.550	0.372	2.675E-17	702	0.243	0.162	Q94BR1.pdb.gz	MRF1_ARATH MA3 DOMAIN-CONTAINING TRANSLATION REGULATORY FACTOR 1 OS=Arabidopsis thaliana OX=3702 GN=MRF1 PE=1 SV=1
6	AFDB:Q8W4Q4	0.537	0.367	8.953E-17	702	0.228	0.152	Q8W4Q4.pdb.gz	MRF3_ARATH MA3 DOMAIN-CONTAINING TRANSLATION REGULATORY FACTOR 3 OS=Arabidopsis thaliana OX=3702 GN=MRF3 PE=1 SV=1
7	AFDB:O80548	0.483	0.342	1.653E-15	693	0.226	0.153	O80548.pdb.gz	MRF2_ARATH MA3 DOMAIN-CONTAINING TRANSLATION REGULATORY FACTOR 2 OS=Arabidopsis thaliana OX=3702 GN=MRF2 PE=1 SV=1
8	AFDB:Q9STL9	0.550	0.412	6.534E-15	633	0.207	0.153	Q9STL9.pdb.gz	MRF4_ARATH MA3 DOMAIN-CONTAINING TRANSLATION REGULATORY FACTOR 4 OS=Arabidopsis thaliana OX=3702 GN=MRF4 PE=1 SV=1
9	AFDB:D3DQV9	0.291	0.156	1.616E-6	907	0.147	0.076	D3DQV9.pdb.gz	D3DQV9_HUMAN Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2 PE=1 SV=1
10	AFDB:H0Y3P2	0.295	0.166	2.255E-6	869	0.145	0.078	H0Y3P2.pdb.gz	H0Y3P2_HUMAN Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2 PE=1 SV=1
11	PDB:4tnmA	0.129	0.144	1.951E-2	407	0.075	0.086	4tnmA.pdb.gz
12	PDB:7sn8D	0.128	0.142	2.611E-2	399	0.072	0.085	7sn8D.pdb.gz	Inositol hexakisphosphate is required for Integrator function.
13	PDB:7lbm2	0.216	0.121	3.216E-2	897	0.098	0.051	7lbm2.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
14	PDB:7dvqV	0.233	0.234	3.644E-2	468	0.100	0.100	7dvqV.pdb.gz	Structure of the activated human minor spliceosome.
15	PDB:7p3xA	0.148	0.128	4.487E-2	576	0.087	0.071	7p3xA.pdb.gz
16	PDB:6ww7B	0.171	0.229	4.678E-2	281	0.094	0.157	6ww7B.pdb.gz	Structural basis for membrane insertion by the human ER membrane protein complex.
17	PDB:3msvA	0.201	0.236	5.084E-2	352	0.079	0.105	3msvA.pdb.gz
18	PDB:4c0qA	0.187	0.114	6.006E-2	871	0.087	0.047	4c0qA.pdb.gz	Structural Basis for Nuclear Import of Splicing Factors by Human Transportin 3.
19	PDB:4c0qB	0.182	0.126	6.528E-2	749	0.083	0.052	4c0qB.pdb.gz	Structural Basis for Nuclear Import of Splicing Factors by Human Transportin 3.
20	PDB:4a0cA	0.180	0.087	8.039E-2	1155	0.094	0.038	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q1L8Y5	0.0	637	470	0.699	0.698	Q1L8Y5_DANRE Programmed cell death protein 4 OS=Danio rerio OX=7955 GN=pdcd4-2 PE=1 SV=1
2	Q53EL6	0.0	961	469	1.000	1.000	PDCD4_HUMAN Programmed cell death protein 4 OS=Homo sapiens OX=9606 GN=PDCD4 PE=1 SV=2
3	Q61823	0.0	938	469	0.968	0.968	PDCD4_MOUSE Programmed cell death protein 4 OS=Mus musculus OX=10090 GN=Pdcd4 PE=1 SV=1
4	Q7ZVK1	0.0	635	470	0.697	0.696	Q7ZVK1_DANRE Programmed cell death protein 4 OS=Danio rerio OX=7955 GN=sb:cb45 PE=1 SV=1
5	Q98TX3	0.0	786	467	0.849	0.852	PDCD4_CHICK Programmed cell death protein 4 OS=Gallus gallus OX=9031 GN=PDCD4 PE=2 SV=1
6	Q9JID1	0.0	939	469	0.968	0.968	PDCD4_RAT Programmed cell death protein 4 OS=Rattus norvegicus OX=10116 GN=Pdcd4 PE=1 SV=2
7	Q9VY91	3.83e-84	270	509	0.307	0.283	Q9VY91_DROME Programmed cell death protein 4 OS=Drosophila melanogaster OX=7227 GN=Pdcd4 PE=1 SV=2
8	Q94BR1	4.78e-41	157	702	0.245	0.164	MRF1_ARATH MA3 DOMAIN-CONTAINING TRANSLATION REGULATORY FACTOR 1 OS=Arabidopsis thaliana OX=3702 GN=MRF1 PE=1 SV=1
9	O80548	2.29e-35	141	693	0.217	0.147	MRF2_ARATH MA3 DOMAIN-CONTAINING TRANSLATION REGULATORY FACTOR 2 OS=Arabidopsis thaliana OX=3702 GN=MRF2 PE=1 SV=1
10	Q9STL9	4.22e-33	134	633	0.207	0.153	MRF4_ARATH MA3 DOMAIN-CONTAINING TRANSLATION REGULATORY FACTOR 4 OS=Arabidopsis thaliana OX=3702 GN=MRF4 PE=1 SV=1
11	Q8W4Q4	5.91e-31	128	702	0.198	0.132	MRF3_ARATH MA3 DOMAIN-CONTAINING TRANSLATION REGULATORY FACTOR 3 OS=Arabidopsis thaliana OX=3702 GN=MRF3 PE=1 SV=1
12	Q76E23	1.46e-05	50.1	1727	0.068	0.019	IF4G_ARATH Eukaryotic translation initiation factor 4G OS=Arabidopsis thaliana OX=3702 GN=EIF4G PE=1 SV=2
13	Q93ZT6	7.59e-05	47.8	780	0.072	0.044	IF4G1_ARATH Eukaryotic translation initiation factor isoform 4G-1 OS=Arabidopsis thaliana OX=3702 GN=EIF(ISO)4G1 PE=1 SV=1
14	P79398	7.89e-05	47.8	907	0.075	0.039	IF4G2_RABIT Eukaryotic translation initiation factor 4 gamma 2 OS=Oryctolagus cuniculus OX=9986 GN=EIF4G2 PE=2 SV=1
15	D3DQV9	1.18e-04	47.0	907	0.068	0.035	D3DQV9_HUMAN Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2 PE=1 SV=1
16	P78344	1.19e-04	47.0	907	0.068	0.035	IF4G2_HUMAN Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2 PE=1 SV=1
17	H0Y3P2	1.28e-04	47.0	869	0.068	0.037	H0Y3P2_HUMAN Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2 PE=1 SV=1
18	Q1MSJ1	2.98e-04	45.8	793	0.062	0.037	Q1MSJ1_ORYGL Putative eukaryotic translation initiation factor 4 gamma OS=Oryza glaberrima OX=4538 GN=eif(iso)4g PE=2 SV=1
19	Q1MSJ0	3.01e-04	45.8	793	0.062	0.037	Q1MSJ0_ORYGL Putative eukaryotic translation initiation factor 4 gamma OS=Oryza glaberrima OX=4538 GN=eif(iso)4g PE=2 SV=1
20	Q1MSJ2	3.11e-04	45.8	790	0.062	0.037	Q1MSJ2_ORYGL Putative eukaryotic translation initiation factor 4 gamma OS=Oryza glaberrima OX=4538 GN=eif(iso)4g PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09085 Adhes-Ig_like	4.3e+02	12.4	Adhesion molecule, immunoglobulin-like
2	PF04774 HABP4_PAI-RBP1	44	16.2	Hyaluronan / mRNA binding family
3	PF02847 MA3	5e-44	160.3	MA3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000280154

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000293831	0.999	Eukaryotic initiation factor 4A-I
2	9606.ENSP00000326381	0.995	Eukaryotic initiation factor 4A-II
3	9606.ENSP00000359206	0.991	F-box/WD repeat-containing protein 1A
4	9606.ENSP00000225577	0.956	Ribosomal protein S6 kinase beta-1
5	9606.ENSP00000376134	0.907	Signal transducer and activator of transcription 4
6	9606.ENSP00000269349	0.884	Eukaryotic initiation factor 4A-III
7	9606.ENSP00000416255	0.882	Eukaryotic translation initiation factor 4 gamma 1
8	9606.ENSP00000425561	0.863	Eukaryotic translation initiation factor 4E
9	9606.ENSP00000361021	0.855	Phosphatase and tensin homolog
10	9606.ENSP00000419851	0.829	GMP synthase [glutamine-hydrolyzing]
11	9606.ENSP00000435777	0.795	Ribosomal protein S13
12	9606.ENSP00000425979	0.779	Ribonuclease 3
13	9606.ENSP00000388806	0.777	Eukaryotic translation initiation factor 4B
14	9606.ENSP00000367202	0.771	Reversion-inducing cysteine-rich protein with Kazal motifs
15	9606.ENSP00000265094	0.766	F-box/WD repeat-containing protein 11
16	9606.ENSP00000369757	0.754	40S ribosomal protein S6
17	9606.ENSP00000351022	0.728	Tropomyosin alpha-1 chain
18	9606.ENSP00000441954	0.724	Mothers against decapentaplegic homolog 5
19	9606.ENSP00000225792	0.698	Probable ATP-dependent RNA helicase DDX5
20	9606.ENSP00000242261	0.695	Twist-related protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	0.429	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0060255	0.994	regulation of macromolecule metabolic process
GO:0048523	0.992	negative regulation of cellular process
GO:0009987	0.991	cellular process
GO:0080090	0.985	regulation of primary metabolic process
GO:0051171	0.985	regulation of nitrogen compound metabolic process
GO:0010468	0.984	regulation of gene expression
GO:0048518	0.982	positive regulation of biological process
GO:0048583	0.981	regulation of response to stimulus
GO:0050896	0.980	response to stimulus
GO:0031323	0.971	regulation of cellular metabolic process
GO:0009892	0.969	negative regulation of metabolic process
GO:0010605	0.960	negative regulation of macromolecule metabolic process
GO:0048522	0.941	positive regulation of cellular process
GO:0051716	0.936	cellular response to stimulus
GO:0009889	0.920	regulation of biosynthetic process
GO:0010660	0.919	regulation of muscle cell apoptotic process
GO:0080134	0.898	regulation of response to stress
GO:0010556	0.881	regulation of macromolecule biosynthetic process
GO:0031326	0.880	regulation of cellular biosynthetic process
GO:0010646	0.870	regulation of cell communication
GO:0048856	0.867	anatomical structure development
GO:0023051	0.862	regulation of signaling
GO:0051172	0.862	negative regulation of nitrogen compound metabolic process
GO:0042221	0.857	response to chemical
GO:0009966	0.839	regulation of signal transduction
GO:0032501	0.836	multicellular organismal process
GO:1902531	0.833	regulation of intracellular signal transduction
GO:0007154	0.826	cell communication
GO:0043069	0.820	negative regulation of programmed cell death
GO:0010033	0.818	response to organic substance
GO:0043066	0.813	negative regulation of apoptotic process
GO:0031324	0.811	negative regulation of cellular metabolic process
GO:0065009	0.794	regulation of molecular function
GO:0023052	0.789	signaling
GO:0060485	0.789	mesenchyme development
GO:0051246	0.784	regulation of protein metabolic process
GO:0019219	0.780	regulation of nucleobase-containing compound metabolic process
GO:0010942	0.772	positive regulation of cell death
GO:0031399	0.771	regulation of protein modification process
GO:0007275	0.763	multicellular organism development
GO:0051252	0.760	regulation of RNA metabolic process
GO:0070887	0.759	cellular response to chemical stimulus
GO:0007165	0.741	signal transduction
GO:0051239	0.739	regulation of multicellular organismal process
GO:0042325	0.724	regulation of phosphorylation
GO:0010604	0.722	positive regulation of macromolecule metabolic process
GO:2001141	0.710	regulation of RNA biosynthetic process
GO:0006355	0.700	regulation of DNA-templated transcription
GO:1903507	0.695	negative regulation of nucleic acid-templated transcription
GO:0043065	0.694	positive regulation of apoptotic process
GO:0001932	0.693	regulation of protein phosphorylation
GO:1902533	0.687	positive regulation of intracellular signal transduction
GO:0045892	0.678	negative regulation of DNA-templated transcription
GO:0048731	0.664	system development
GO:0042127	0.662	regulation of cell population proliferation
GO:0050793	0.654	regulation of developmental process
GO:0009719	0.649	response to endogenous stimulus
GO:0048585	0.644	negative regulation of response to stimulus
GO:0009968	0.626	negative regulation of signal transduction
GO:0071495	0.621	cellular response to endogenous stimulus
GO:0030154	0.580	cell differentiation
GO:0045595	0.572	regulation of cell differentiation
GO:0080135	0.546	regulation of cellular response to stress
GO:0048660	0.532	regulation of smooth muscle cell proliferation
GO:0050790	0.515	regulation of catalytic activity
GO:0007507	0.501	heart development
GO:0051093	0.481	negative regulation of developmental process
GO:0007166	0.475	cell surface receptor signaling pathway
GO:0045936	0.472	negative regulation of phosphate metabolic process
GO:0051173	0.465	positive regulation of nitrogen compound metabolic process
GO:0043408	0.464	regulation of MAPK cascade
GO:0070848	0.447	response to growth factor
GO:0008152	0.414	metabolic process
GO:0071704	0.345	organic substance metabolic process
GO:0044237	0.328	cellular metabolic process
GO:0009605	0.323	response to external stimulus
GO:0031325	0.321	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005829	0.982	cytosol
GO:0031981	0.631	nuclear lumen
GO:0005654	0.525	nucleoplasm
GO:0032991	0.496	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]