StarFunc result for job id Q53EP0

User Input

>input (1204 residues)
MYVTMMMTDQIPLELPPLLNGEVAMMPHLVNGDAAQQVILVQVNPGETFTIRAEDGTLQC
IQGPAEVPMMSPNGSIPPIHVPPGYISQVIEDSTGVRRVVVTPQSPECYPPSYPSAMSPT
HHLPPYLTHHPHFIHNSHTAYYPPVTGPGDMPPQFFPQHHLPHTIYGEQEIIPFYGMSTY
ITREDQYSKPPHKKLKDRQIDRQNRLNSPPSSIYKSSCTTVYNGYGKGHSGGSGGGGSGS
GPGIKKTERRARSSPKSNDSDLQEYELEVKRVQDILSGIEKPQVSNIQARAVVLSWAPPV
GLSCGPHSGLSFPYSYEVALSDKGRDGKYKIIYSGEELECNLKDLRPATDYHVRVYAMYN
SVKGSCSEPVSFTTHSCAPECPFPPKLAHRSKSSLTLQWKAPIDNGSKITNYLLEWDEGK
RNSGFRQCFFGSQKHCKLTKLCPAMGYTFRLAARNDIGTSGYSQEVVCYTLGNIPQMPSA
PRLVRAGITWVTLQWSKPEGCSPEEVITYTLEIQEDENDNLFHPKYTGEDLTCTVKNLKR
STQYKFRLTASNTEGKSCPSEVLVCTTSPDRPGPPTRPLVKGPVTSHGFSVKWDPPKDNG
GSEILKYLLEITDGNSEANQWEVAYSGSATEYTFTHLKPGTLYKLRACCISTGGHSQCSE
SLPVRTLSIAPGQCRPPRVLGRPKHKEVHLEWDVPASESGCEVSEYSVEMTEPEDVASEV
YHGPELECTVGNLLPGTVYRFRVRALNDGGYGPYSDVSEITTAAGPPGQCKAPCISCTPD
GCVLVGWESPDSSGADISEYRLEWGEDEESLELIYHGTDTRFEIRDLLPAAQYCCRLQAF
NQAGAGPYSELVLCQTPASAPDPVSTLCVLEEEPLDAYPDSPSACLVLNWEEPCNNGSEI
LAYTIDLGDTSITVGNTTMHVMKDLLPETTYRIRIQAINEIGAGPFSQFIKAKTRPLPPL
PPRLECAAAGPQSLKLKWGDSNSKTHAAEDIVYTLQLEDRNKRFISIYRGPSHTYKVQRL
TEFTCYSFRIQAASEAGEGPFSETYTFSTTKSVPPTIKAPRVTQLEGNSCEILWETVPSM
KGDPVNYILQVLVGRESEYKQVYKGEEATFQISGLQTNTDYRFRVCACRRCLDTSQELSG
AFSPSAAFVLQRSEVMLTGDMGSLDDPKMKSMMPTDEQFAAIIVLGFATLSILFAFILQY
FLMK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140LGL5	0.351	0.348	0.000	1215	0.469	0.465	A0A140LGL5.pdb.gz
2	AFDB:Q6NWW9	0.422	0.421	0.000	1207	0.929	0.927	Q6NWW9.pdb.gz	FND3B_MOUSE Fibronectin type III domain-containing protein 3B OS=Mus musculus OX=10090 GN=Fndc3b PE=1 SV=1
3	AFDB:Q92859	0.132	0.111	7.792E-36	1461	0.139	0.114	Q92859.pdb.gz	NEO1_HUMAN Neogenin OS=Homo sapiens OX=9606 GN=NEO1 PE=1 SV=2
4	AFDB:F1R2D2	0.180	0.138	2.977E-20	1687	0.125	0.090	F1R2D2.pdb.gz
5	AFDB:G5EBF1	0.172	0.166	1.099E-19	1273	0.115	0.108	G5EBF1.pdb.gz	SAX3_CAEEL Protein sax-3 OS=Caenorhabditis elegans OX=6239 GN=sax-3 PE=2 SV=1
6	AFDB:Q3V1M1	0.140	0.089	1.259E-18	2594	0.127	0.059	Q3V1M1.pdb.gz	IGS10_MOUSE Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2
7	PDB:5a42A	0.107	0.088	7.976E-18	1597	0.102	0.077	5a42A.pdb.gz
8	AFDB:Q9Z2I4	0.167	0.151	1.266E-17	1366	0.109	0.096	Q9Z2I4.pdb.gz	ROBO3_MOUSE Roundabout homolog 3 OS=Mus musculus OX=10090 GN=Robo3 PE=1 SV=2
9	PDB:6h03A	0.081	0.080	2.611E-15	1223	0.084	0.083	6h03A.pdb.gz
10	PDB:7q5zA	0.085	0.079	1.853E-14	1344	0.074	0.066	7q5zA.pdb.gz
11	PDB:7q1yA	0.078	0.073	2.513E-14	1374	0.098	0.086	7q1yA.pdb.gz
12	AFDB:Q4ZHG4	0.138	0.091	3.207E-14	1894	0.061	0.039	Q4ZHG4.pdb.gz	FNDC1_HUMAN Fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FNDC1 PE=2 SV=4
13	PDB:1e07A	0.144	0.228	1.258E-13	642	0.061	0.114	1e07A.pdb.gz
14	PDB:5oj2B	0.119	0.184	3.578E-13	692	0.080	0.139	5oj2B.pdb.gz
15	PDB:6pxvA	0.169	0.231	4.472E-12	823	0.051	0.074	6pxvA.pdb.gz
16	PDB:7nycA	0.083	0.070	4.472E-12	1542	0.086	0.067	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
17	PDB:4ziqA	0.103	0.090	6.912E-12	1450	0.081	0.067	4ziqA.pdb.gz
18	PDB:8eyyA	0.160	0.230	1.166E-11	775	0.051	0.079	8eyyA.pdb.gz
19	AFDB:Q9VZT8	0.106	0.094	2.873E-10	1443	0.096	0.080	Q9VZT8.pdb.gz	Q9VZT8_DROME Myomesin and myosin binding protein OS=Drosophila melanogaster OX=7227 GN=MnM PE=4 SV=3
20	AFDB:Q9BYH1	0.070	0.078	5.113E-8	1024	0.099	0.116	Q9BYH1.pdb.gz	SE6L1_HUMAN Seizure 6-like protein OS=Homo sapiens OX=9606 GN=SEZ6L PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q53EP0	0.0	2496	1204	1.000	1.000	FND3B_HUMAN Fibronectin type III domain-containing protein 3B OS=Homo sapiens OX=9606 GN=FNDC3B PE=1 SV=2
2	Q6NWW9	0.0	2256	1207	0.926	0.924	FND3B_MOUSE Fibronectin type III domain-containing protein 3B OS=Mus musculus OX=10090 GN=Fndc3b PE=1 SV=1
3	Q8BX90	0.0	1157	1198	0.498	0.501	FND3A_MOUSE Fibronectin type-III domain-containing protein 3A OS=Mus musculus OX=10090 GN=Fndc3a PE=1 SV=3
4	Q9Y2H6	0.0	1187	1198	0.512	0.514	FND3A_HUMAN Fibronectin type-III domain-containing protein 3A OS=Homo sapiens OX=9606 GN=FNDC3A PE=1 SV=4
5	Q9VJJ8	2.83e-120	407	1413	0.269	0.229	Q9VJJ8_DROME LD30602p OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=2
6	Q9VJJ9	4.47e-119	408	1762	0.269	0.184	Q9VJJ9_DROME FI20237p1 OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=4
7	M9PD19	4.73e-119	408	1779	0.269	0.182	M9PD19_DROME Miles to go, isoform H OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=1
8	B7YZW3	2.32e-118	408	2064	0.269	0.157	B7YZW3_DROME Miles to go, isoform E OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=1
9	P16621	4.57e-38	158	2029	0.170	0.101	LAR_DROME Tyrosine-protein phosphatase Lar OS=Drosophila melanogaster OX=7227 GN=Lar PE=1 SV=2
10	A0A8I5ZU83	2.19e-37	156	26931	0.183	0.008	A0A8I5ZU83_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
11	A2ASS6	2.29e-37	156	35213	0.182	0.006	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
12	A0A8I5ZUN3	3.17e-37	156	35375	0.183	0.006	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
13	Q8WZ42	3.25e-36	152	34350	0.181	0.006	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
14	Q8K3K1	1.95e-32	140	5125	0.179	0.042	USH2A_RAT Usherin OS=Rattus norvegicus OX=10116 GN=Ush2a PE=1 SV=2
15	Q2QI47	7.51e-32	138	5193	0.179	0.042	USH2A_MOUSE Usherin OS=Mus musculus OX=10090 GN=Ush2A PE=1 SV=2
16	A2A8L5	1.05e-31	137	1898	0.146	0.093	PTPRF_MOUSE Receptor-type tyrosine-protein phosphatase F OS=Mus musculus OX=10090 GN=Ptprf PE=1 SV=1
17	Q64604	1.45e-31	137	1898	0.149	0.094	PTPRF_RAT Receptor-type tyrosine-protein phosphatase F OS=Rattus norvegicus OX=10116 GN=Ptprf PE=2 SV=1
18	A4IFW2	1.56e-31	137	1909	0.164	0.104	PTPRF_DANRE Receptor-type tyrosine-protein phosphatase F OS=Danio rerio OX=7955 GN=ptprf PE=2 SV=1
19	A0A0R4IIB3	6.11e-31	135	1409	0.135	0.115	A0A0R4IIB3_DANRE Neogenin 1a OS=Danio rerio OX=7955 GN=cb333 PE=3 SV=2
20	P10586	8.83e-31	134	1907	0.146	0.092	PTPRF_HUMAN Receptor-type tyrosine-protein phosphatase F OS=Homo sapiens OX=9606 GN=PTPRF PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00041 fn3	2.5e-93	317.9	Fibronectin type III domain
2	PF07679 I-set	3.9e+02	12.5	Immunoglobulin I-set domain
3	PF09294 Interfer-bind	3.9e-06	38.5	Interferon-alpha/beta receptor, fibronectin type III
4	PF10179 NDNF	2.3e-10	52.1	Neuron-derived neurotrophic factor, first Fn(III) domain
5	PF16656 Pur_ac_phosph_N	1.9e-24	97.4	Purple acid Phosphatase, N-terminal domain
6	PF14292 SusE	0.022	26.4	SusE outer membrane protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000338523

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000402343	0.659	Zinc finger protein 469
2	9606.ENSP00000322300	0.641	Transmembrane and tetratricopeptide repeat containing 2
3	9606.ENSP00000342295	0.639	Ankyrin repeat domain-containing protein 55
4	9606.ENSP00000288670	0.632	Formin-like protein 2
5	9606.ENSP00000480514	0.602	Calcium load-activated calcium channel
6	9606.ENSP00000407552	0.554	Growth arrest-specific protein 7
7	9606.ENSP00000357835	0.551	Phospholysine phosphohistidine inorganic pyrophosphate phosphatase
8	9606.ENSP00000363714	0.538	Belongs to the autoinducer-2 exporter (AI-2E) (TC 2.A.86) family
9	9606.ENSP00000370194	0.530	GDP-mannose 4,6 dehydratase
10	9606.ENSP00000263736	0.519	S1 RNA-binding domain-containing protein 1
11	9606.ENSP00000439807	0.519	Multiple PDZ domain protein
12	9606.ENSP00000263925	0.518	E3 ubiquitin-protein ligase LNX
13	9606.ENSP00000410689	0.517	Actin filament-associated protein 1
14	9606.ENSP00000287590	0.515	UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7
15	9606.ENSP00000328596	0.506	Homeobox protein SIX6
16	9606.ENSP00000376902	0.505	Protein BANP

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	0.998	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050789	0.987	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0048856	0.953	anatomical structure development
GO:0032501	0.951	multicellular organismal process
GO:0007275	0.857	multicellular organism development
GO:0050793	0.748	regulation of developmental process
GO:0048518	0.681	positive regulation of biological process
GO:0048519	0.651	negative regulation of biological process
GO:0048523	0.620	negative regulation of cellular process
GO:0048731	0.573	system development
GO:0048522	0.544	positive regulation of cellular process
GO:0045595	0.427	regulation of cell differentiation
GO:0007155	0.412	cell adhesion
GO:0048513	0.411	animal organ development
GO:0042127	0.380	regulation of cell population proliferation
GO:0030154	0.326	cell differentiation
GO:0048145	0.308	regulation of fibroblast proliferation
GO:0045667	0.307	regulation of osteoblast differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0012505	0.999	endomembrane system
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005783	0.951	endoplasmic reticulum
GO:0016020	0.899	membrane
GO:0005829	0.692	cytosol
GO:0031982	0.309	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]