StarFunc result for job id Q53ET0

User Input

>input (693 residues)
MATSGANGPGSATASASNPRKFSEKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLA
YTRSSHYGGSLPNVNQIGSGLAEFQSPLHSPLDSSRSTRHHGLVERVQRDPRRMVSPLRR
YTRHIDSSPYSPAYLSPPPESSWRRTMAWGNFPAEKGQLFRLPSALNRTSSDSALHTSVM
NPSPQDTYPGPTPPSILPSRRGGILDGEMDPKVPAIEENLLDDKHLLKPWDAKKLSSSSS
RPRSCEVPGINIFPSPDQPANVPVLPPAMNTGGSLPDLTNLHFPPPLPTPLDPEETAYPS
LSGGNSTSNLTHTMTHLGISRGMGLGPGYDAPGLHSPLSHPSLQSSLSNPNLQASLSSPQ
PQLQGSHSHPSLPASSLARHVLPTTSLGHPSLSAPALSSSSSSSSTSSPVLGAPSYPAST
PGASPHHRRVPLSPLSLLAGPADARRSQQQLPKQFSPTMSPTLSSITQGVPLDTSKLSTD
QRLPPYPYSSPSLVLPTQPHTPKSLQQPGLPSQSCSVQSSGGQPPGRQSHYGTPYPPGPS
GHGQQSYHRPMSDFNLGNLEQFSMESPSASLVLDPPGFSEGPGFLGGEGPMGGPQDPHTF
NHQNLTHCSRHGSGPNIILTGDSSPGFSKEIAAALAGVPGFEVSAAGLELGLGLEDELRM
EPLGLEGLNMLSDPCALLPDPAVEESFRSDRLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q53ET0	0.999	0.999	3.352E-95	693	1.000	1.000	Q53ET0.pdb.gz	CRTC2_HUMAN CREB-regulated transcription coactivator 2 OS=Homo sapiens OX=9606 GN=CRTC2 PE=1 SV=2
2	AFDB:Q91X84	0.111	0.121	2.182E-21	619	0.374	0.418	Q91X84.pdb.gz	CRTC3_MOUSE CREB-regulated transcription coactivator 3 OS=Mus musculus OX=10090 GN=Crtc3 PE=1 SV=2
3	AFDB:Q6UUV7	0.128	0.140	3.035E-21	619	0.372	0.417	Q6UUV7.pdb.gz	CRTC3_HUMAN CREB-regulated transcription coactivator 3 OS=Homo sapiens OX=9606 GN=CRTC3 PE=1 SV=2
4	AFDB:Q8T9B8	0.074	0.061	1.628E-1	874	0.137	0.109	Q8T9B8.pdb.gz	Q8T9B8_DROME SD08060p OS=Drosophila melanogaster OX=7227 GN=Brd8 PE=2 SV=1
5	AFDB:A7XY94	0.057	0.030	2.419E-1	1448	0.137	0.066	A7XY94.pdb.gz	NMDE2_XENLA Glutamate receptor ionotropic, NMDA 2B OS=Xenopus laevis OX=8355 GN=grin2b PE=1 SV=1
6	AFDB:X2JC00	0.051	0.026	2.761E-1	1404	0.149	0.073	X2JC00.pdb.gz	X2JC00_DROME Rho GTPase activating protein at 1A, isoform E OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
7	AFDB:Q10268	0.061	0.057	6.514E-1	756	0.172	0.157	Q10268.pdb.gz	MAC1_SCHPO Membrane-anchored protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mac1 PE=1 SV=1
8	AFDB:A1L1S4	0.071	0.078	7.941E-1	618	0.146	0.163	A1L1S4.pdb.gz	A1L1S4_DANRE Shugoshin-like 1 OS=Danio rerio OX=7955 GN=sgol1 PE=2 SV=1
9	AFDB:Q7TN08	0.056	0.057	1.439	757	0.156	0.143	Q7TN08.pdb.gz	DACT2_MOUSE Dapper homolog 2 OS=Mus musculus OX=10090 GN=Dact2 PE=1 SV=2
10	AFDB:Q9W3Q5	0.066	0.042	1.439	1268	0.154	0.084	Q9W3Q5.pdb.gz	Q9W3Q5_DROME Checkpoint suppressor 1-like, isoform A OS=Drosophila melanogaster OX=7227 GN=CHES-1-like PE=4 SV=4
11	PDB:5yzgL	0.055	0.085	2.794	419	0.016	0.026	5yzgL.pdb.gz	Structure of a human catalytic step I spliceosome
12	PDB:6hivCR	0.046	0.092	2.794	314	0.030	0.067	6hivCR.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
13	PDB:6zr2h	0.060	0.248	4.152	138	0.020	0.101	6zr2h.pdb.gz	Structure of inhibitor-bound mammalian complex I.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3LRZ1	0.0	1121	691	0.921	0.923	CRTC2_RAT CREB-regulated transcription coactivator 2 OS=Rattus norvegicus OX=10116 GN=Crtc2 PE=1 SV=1
2	Q3U182	0.0	1120	692	0.922	0.923	CRTC2_MOUSE CREB-regulated transcription coactivator 2 OS=Mus musculus OX=10090 GN=Crtc2 PE=1 SV=2
3	Q53ET0	0.0	1364	693	1.000	1.000	CRTC2_HUMAN CREB-regulated transcription coactivator 2 OS=Homo sapiens OX=9606 GN=CRTC2 PE=1 SV=2
4	Q5T4K5	0.0	662	373	0.492	0.914	Q5T4K5_HUMAN CREB regulated transcription coactivator 2 OS=Homo sapiens OX=9606 GN=CRTC2 PE=1 SV=1
5	Q91X84	2.93e-89	293	619	0.388	0.435	CRTC3_MOUSE CREB-regulated transcription coactivator 3 OS=Mus musculus OX=10090 GN=Crtc3 PE=1 SV=2
6	Q6UUV7	3.20e-88	290	619	0.381	0.426	CRTC3_HUMAN CREB-regulated transcription coactivator 3 OS=Homo sapiens OX=9606 GN=CRTC3 PE=1 SV=2
7	Q6UUV9	3.05e-82	275	634	0.244	0.267	CRTC1_HUMAN CREB-regulated transcription coactivator 1 OS=Homo sapiens OX=9606 GN=CRTC1 PE=1 SV=2
8	Q157S1	3.61e-76	258	630	0.244	0.268	CRTC1_RAT CREB-regulated transcription coactivator 1 OS=Rattus norvegicus OX=10116 GN=Crtc1 PE=1 SV=1
9	Q68ED7	9.31e-74	252	630	0.242	0.267	CRTC1_MOUSE CREB-regulated transcription coactivator 1 OS=Mus musculus OX=10090 GN=Crtc1 PE=1 SV=1
10	M0QX46	4.86e-63	222	593	0.199	0.233	M0QX46_HUMAN CREB regulated transcription coactivator 1 OS=Homo sapiens OX=9606 GN=CRTC1 PE=1 SV=1
11	M0QXN6	2.34e-53	190	392	0.173	0.306	M0QXN6_HUMAN CREB regulated transcription coactivator 1 OS=Homo sapiens OX=9606 GN=CRTC1 PE=1 SV=1
12	H0YK64	1.53e-27	112	190	0.117	0.426	H0YK64_HUMAN CREB regulated transcription coactivator 3 (Fragment) OS=Homo sapiens OX=9606 GN=CRTC3 PE=1 SV=1
13	Q9VVJ8	7.26e-07	55.1	797	0.033	0.029	Q9VVJ8_DROME CREB-regulated transcription coactivator, isoform A OS=Drosophila melanogaster OX=7227 GN=Crtc PE=1 SV=1
14	M9PFU2	8.71e-07	54.7	889	0.033	0.026	M9PFU2_DROME CREB-regulated transcription coactivator, isoform B OS=Drosophila melanogaster OX=7227 GN=Crtc PE=1 SV=1
15	Q95XA8	2.40e-04	46.6	486	0.075	0.107	CRTC1_CAEEL CREB-regulated transcription coactivator 1 homolog OS=Caenorhabditis elegans OX=6239 GN=crtc-1 PE=1 SV=4
16	A0PJF4	2.7	33.9	1564	0.033	0.015	A0PJF4_MOUSE Ahnak protein (Fragment) OS=Mus musculus OX=10090 GN=Ahnak PE=2 SV=1
17	Q8BKS2	4.2	33.1	939	0.033	0.024	Q8BKS2_MOUSE Ahnak protein (Fragment) OS=Mus musculus OX=10090 GN=Ahnak PE=2 SV=2
18	Q8VDN3	5.6	32.7	1024	0.033	0.022	Q8VDN3_MOUSE Ahnak protein (Fragment) OS=Mus musculus OX=10090 GN=Ahnak PE=2 SV=1
19	Q8CGE7	10.0	32.0	665	0.033	0.035	Q8CGE7_MOUSE Ahnak protein (Fragment) OS=Mus musculus OX=10090 GN=Ahnak PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12886 TORC_C	6.9e-26	101.9	Transducer of regulated CREB activity, C terminus
2	PF12885 TORC_M	4.1e-63	223.5	Transducer of regulated CREB activity middle domain
3	PF12884 TORC_N	1.2e-14	66.1	Transducer of regulated CREB activity, N terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357622

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000387699	0.999	Cyclic AMP-responsive element-binding protein 1
2	9606.ENSP00000305976	0.991	Serine/threonine-protein kinase SIK2
3	9606.ENSP00000262367	0.981	CREB-binding protein
4	9606.ENSP00000270162	0.977	Serine/threonine-protein kinase SIK1
5	9606.ENSP00000264867	0.972	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
6	9606.ENSP00000364449	0.972	Serine/threonine-protein kinase SIK3
7	9606.ENSP00000371267	0.967	14-3-3 protein theta
8	9606.ENSP00000264335	0.964	14-3-3 protein epsilon
9	9606.ENSP00000361930	0.945	14-3-3 protein beta/alpha
10	9606.ENSP00000379287	0.936	14-3-3 protein zeta/delta
11	9606.ENSP00000263253	0.932	Histone acetyltransferase p300
12	9606.ENSP00000306330	0.915	14-3-3 protein gamma
13	9606.ENSP00000248975	0.911	14-3-3 protein eta
14	9606.ENSP00000362824	0.903	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
15	9606.ENSP00000340989	0.902	14-3-3 protein sigma
16	9606.ENSP00000378323	0.899	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
17	9606.ENSP00000378306	0.895	Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
18	9606.ENSP00000380878	0.895	Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform
19	9606.ENSP00000346148	0.891	5'-AMP-activated protein kinase catalytic subunit alpha-1
20	9606.ENSP00000078445	0.886	Cyclic AMP-responsive element-binding protein 3-like protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.865	regulation of biological process
GO:0042593	0.865	glucose homeostasis
GO:0050794	0.864	regulation of cellular process
GO:0019222	0.795	regulation of metabolic process
GO:0048522	0.793	positive regulation of cellular process
GO:0031323	0.753	regulation of cellular metabolic process
GO:0009987	0.721	cellular process
GO:0080090	0.716	regulation of primary metabolic process
GO:0060255	0.712	regulation of macromolecule metabolic process
GO:0051171	0.682	regulation of nitrogen compound metabolic process
GO:0050896	0.646	response to stimulus
GO:0009893	0.550	positive regulation of metabolic process
GO:0019219	0.549	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.544	regulation of biosynthetic process
GO:0031326	0.523	regulation of cellular biosynthetic process
GO:0031325	0.515	positive regulation of cellular metabolic process
GO:0010604	0.506	positive regulation of macromolecule metabolic process
GO:0010556	0.504	regulation of macromolecule biosynthetic process
GO:0010468	0.495	regulation of gene expression
GO:0051173	0.475	positive regulation of nitrogen compound metabolic process
GO:0008152	0.467	metabolic process
GO:0051252	0.433	regulation of RNA metabolic process
GO:0071704	0.431	organic substance metabolic process
GO:0006355	0.421	regulation of DNA-templated transcription
GO:0010557	0.405	positive regulation of macromolecule biosynthetic process
GO:0031328	0.405	positive regulation of cellular biosynthetic process
GO:0045935	0.405	positive regulation of nucleobase-containing compound metabolic process
GO:0044238	0.402	primary metabolic process
GO:0051254	0.398	positive regulation of RNA metabolic process
GO:0045893	0.343	positive regulation of DNA-templated transcription
GO:0032501	0.321	multicellular organismal process
GO:0006357	0.312	regulation of transcription by RNA polymerase II
GO:0006807	0.306	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005737	0.996	cytoplasm
GO:0005654	0.991	nucleoplasm
GO:0005829	0.407	cytosol
GO:0070062	0.388	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]