StarFunc result for job id Q53EU6

User Input

>input (434 residues)
MEGAELAGKILSTWLTLVLGFILLPSVFGVSLGISEIYMKILVKTLEWATIRIEKGTPKE
SILKNSASVGIIQRDESPMEKGLSGLRGRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEE
LVSWNLLTRTNVNFQYISLRLTMVWVLGVIVRYCVLLPLRVTLAFIGISLLVIGTTLVGQ
LPDSSLKNWLSELVHLTCCRICVRALSGTIHYHNKQYRPQKGGICVANHTSPIDVLILTT
DGCYAMVGQVHGGLMGIIQRAMVKACPHVWFERSEMKDRHLVTKRLKEHIADKKKLPILI
FPEGTCINNTSVMMFKKGSFEIGGTIHPVAIKYNPQFGDAFWNSSKYNMVSYLLRMMTSW
AIVCDVWYMPPMTREEGEDAVQFANRVKSAIAIQGGLTELPWDGGLKRAKVKDIFKEEQQ
KNYSKMIVGNGSLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8C0N2	0.966	0.958	1.660E-72	438	0.942	0.934	Q8C0N2.pdb.gz	GPAT3_MOUSE Glycerol-3-phosphate acyltransferase 3 OS=Mus musculus OX=10090 GN=Gpat3 PE=1 SV=1
2	AFDB:Q86UL3	0.921	0.878	3.768E-60	456	0.691	0.658	Q86UL3.pdb.gz	GPAT4_HUMAN Glycerol-3-phosphate acyltransferase 4 OS=Homo sapiens OX=9606 GN=GPAT4 PE=1 SV=1
3	AFDB:Q9W1B5	0.880	0.833	2.067E-48	459	0.477	0.451	Q9W1B5.pdb.gz	Q9W1B5_DROME Glycerol-3-phosphate acyltransferase 4, isoform C OS=Drosophila melanogaster OX=7227 GN=Gpat4 PE=1 SV=2
4	AFDB:Q960R0	0.883	0.839	6.163E-48	458	0.488	0.463	Q960R0.pdb.gz	Q960R0_DROME Glycerol-3-phosphate acyltransferase 4, isoform B OS=Drosophila melanogaster OX=7227 GN=Gpat4 PE=1 SV=1
5	AFDB:Q9N5S8	0.873	0.622	5.782E-47	617	0.500	0.352	Q9N5S8.pdb.gz	Q9N5S8_CAEEL Phospholipid/glycerol acyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acl-4 PE=1 SV=1
6	AFDB:Q21812	0.878	0.749	1.724E-46	512	0.442	0.375	Q21812.pdb.gz	Q21812_CAEEL Phospholipid/glycerol acyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acl-5 PE=1 SV=1
7	AFDB:A0A0B4LGJ9	0.561	0.457	6.569E-43	537	0.495	0.400	A0A0B4LGJ9.pdb.gz	A0A0B4LGJ9_DROME Glycerol-3-phosphate acyltransferase 4, isoform D OS=Drosophila melanogaster OX=7227 GN=Gpat4 PE=1 SV=1
8	AFDB:Q8GWG0	0.699	0.800	4.058E-32	376	0.290	0.335	Q8GWG0.pdb.gz	GPAT9_ARATH Glycerol-3-phosphate acyltransferase 9 OS=Arabidopsis thaliana OX=3702 GN=GPAT9 PE=1 SV=1
9	AFDB:Q554U0	0.673	0.603	7.814E-32	488	0.325	0.289	Q554U0.pdb.gz	Q554U0_DICDI Phospholipid/glycerol acyltransferase domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274969 PE=3 SV=1
10	AFDB:G5EE59	0.753	0.742	2.769E-26	441	0.247	0.243	G5EE59.pdb.gz	G5EE59_CAEEL Phospholipid/glycerol acyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_M79.2 PE=1 SV=1
11	PDB:5f2tB	0.238	0.353	9.784E-4	262	0.071	0.118	5f2tB.pdb.gz	Structural basis for selective recognition of acyl chains by the membrane-associated acyltransferase PatA.
12	PDB:3jz4A	0.125	0.116	3.975E-1	481	0.055	0.050	3jz4A.pdb.gz	The X-ray crystal structure of Escherichia coli succinic semialdehyde dehydrogenase; structural insights into NADP+/enzyme interactions.
13	PDB:7quyA	0.149	0.177	5.222E-1	352	0.041	0.051	7quyA.pdb.gz	Advanced Insights into Catalytic and Structural Features of the Zinc-Dependent Alcohol Dehydrogenase from Thauera aromatica.
14	PDB:7wkwB	0.090	0.100	8.083E-1	377	0.065	0.074	7wkwB.pdb.gz	Structures and mechanisms of the Arabidopsis auxin transporter PIN3.
15	PDB:2gamC	0.140	0.158	1.122	374	0.032	0.037	2gamC.pdb.gz	X-ray Crystal Structure of Leukocyte Type Core 2 beta1,6-N-Acetylglucosaminyltransferase: Evidence for a covergence of metal ion independent glycosyltransferase mechanism.
16	PDB:3g5aB	0.112	0.147	1.251	305	0.046	0.066	3g5aB.pdb.gz	Structure and mechanism of a eukaryotic FMN adenylyltransferase.
17	PDB:4iwnA	0.078	0.115	1.251	229	0.067	0.127	4iwnA.pdb.gz	S-Adenosyl-S-carboxymethyl-L-homocysteine: a novel cofactor found in the putative tRNA-modifying enzyme CmoA.
18	PDB:2w8qA	0.133	0.122	1.474	485	0.067	0.060	2w8qA.pdb.gz	Redox-Switch Modulation of Human Ssadh by Dynamic Catalytic Loop.
19	PDB:3a4tA	0.141	0.204	1.474	258	0.028	0.047	3a4tA.pdb.gz	Crystal structure of Methanocaldococcus jannaschii Trm4 complexed with sinefungin.
20	PDB:4f86A	0.097	0.119	1.474	275	0.053	0.084	4f86A.pdb.gz	Structure analysis of geranyl pyrophosphate methyltransferase and the proposed reaction mechanism of SAM-dependent C-methylation

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q53EU6	0.0	895	434	1.000	1.000	GPAT3_HUMAN Glycerol-3-phosphate acyltransferase 3 OS=Homo sapiens OX=9606 GN=GPAT3 PE=1 SV=2
2	Q86UL3	0.0	625	456	0.677	0.645	GPAT4_HUMAN Glycerol-3-phosphate acyltransferase 4 OS=Homo sapiens OX=9606 GN=GPAT4 PE=1 SV=1
3	Q8C0N2	0.0	853	438	0.942	0.934	GPAT3_MOUSE Glycerol-3-phosphate acyltransferase 3 OS=Mus musculus OX=10090 GN=Gpat3 PE=1 SV=1
4	Q8K2C8	0.0	627	456	0.677	0.645	GPAT4_MOUSE Glycerol-3-phosphate acyltransferase 4 OS=Mus musculus OX=10090 GN=Gpat4 PE=1 SV=1
5	Q9W1B5	2.35e-153	444	459	0.479	0.453	Q9W1B5_DROME Glycerol-3-phosphate acyltransferase 4, isoform C OS=Drosophila melanogaster OX=7227 GN=Gpat4 PE=1 SV=2
6	Q960R0	5.42e-152	441	458	0.488	0.463	Q960R0_DROME Glycerol-3-phosphate acyltransferase 4, isoform B OS=Drosophila melanogaster OX=7227 GN=Gpat4 PE=1 SV=1
7	Q9N5S8	3.22e-145	429	617	0.468	0.329	Q9N5S8_CAEEL Phospholipid/glycerol acyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acl-4 PE=1 SV=1
8	Q9N5S9	5.90e-145	421	410	0.440	0.466	Q9N5S9_CAEEL Phospholipid/glycerol acyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acl-4 PE=1 SV=2
9	Q21812	1.13e-135	401	512	0.449	0.381	Q21812_CAEEL Phospholipid/glycerol acyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acl-5 PE=1 SV=1
10	Q1ZXU8	1.30e-133	394	455	0.403	0.385	Q1ZXU8_CAEEL Phospholipid/glycerol acyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acl-5 PE=1 SV=1
11	A0A0B4LGJ9	1.32e-118	358	537	0.472	0.382	A0A0B4LGJ9_DROME Glycerol-3-phosphate acyltransferase 4, isoform D OS=Drosophila melanogaster OX=7227 GN=Gpat4 PE=1 SV=1
12	A0A0B4LHH1	4.81e-91	282	380	0.288	0.329	A0A0B4LHH1_DROME Glycerol-3-phosphate acyltransferase 4, isoform E OS=Drosophila melanogaster OX=7227 GN=Gpat4 PE=1 SV=1
13	Q554U0	1.87e-87	276	488	0.327	0.291	Q554U0_DICDI Phospholipid/glycerol acyltransferase domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274969 PE=3 SV=1
14	Q8GWG0	5.43e-79	251	376	0.313	0.362	GPAT9_ARATH Glycerol-3-phosphate acyltransferase 9 OS=Arabidopsis thaliana OX=3702 GN=GPAT9 PE=1 SV=1
15	G5EE59	3.42e-49	175	441	0.240	0.236	G5EE59_CAEEL Phospholipid/glycerol acyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_M79.2 PE=1 SV=1
16	Q0KHU5	5.80e-17	85.1	533	0.152	0.124	PCAT_DROME Lysophosphatidylcholine acyltransferase OS=Drosophila melanogaster OX=7227 GN=LPCAT PE=2 SV=1
17	Q8BYI6	1.13e-13	75.1	544	0.157	0.125	PCAT2_MOUSE Lysophosphatidylcholine acyltransferase 2 OS=Mus musculus OX=10090 GN=Lpcat2 PE=1 SV=1
18	Q8L7R3	1.02e-11	68.6	398	0.113	0.123	LPCT1_ARATH Lysophospholipid acyltransferase LPEAT1 OS=Arabidopsis thaliana OX=3702 GN=LPEAT1 PE=1 SV=1
19	Q7L5N7	7.34e-11	66.2	544	0.101	0.081	PCAT2_HUMAN Lysophosphatidylcholine acyltransferase 2 OS=Homo sapiens OX=9606 GN=LPCAT2 PE=1 SV=1
20	Q8S8S2	3.24e-10	64.3	539	0.120	0.096	LPCT2_ARATH Lysophospholipid acyltransferase LPEAT2 OS=Arabidopsis thaliana OX=3702 GN=LPEAT2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01553 Acyltransferase	9.6e-16	69.1	Acyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000011142

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000000011	0.989	Glycerol-3-phosphate acyltransferase 2, mitochondrial
2	61853.ENSNLEP00000019038	0.987	Glycerol-3-phosphate acyltransferase, mitochondrial
3	61853.ENSNLEP00000010178	0.981	1-acylglycerol-3-phosphate O-acyltransferase 2
4	61853.ENSNLEP00000002166	0.979	1-acylglycerol-3-phosphate O-acyltransferase 3
5	61853.ENSNLEP00000018159	0.977	1-acylglycerol-3-phosphate O-acyltransferase 5
6	61853.ENSNLEP00000013935	0.976	Uncharacterized protein
7	61853.ENSNLEP00000018778	0.964	Lysocardiolipin acyltransferase 1
8	61853.ENSNLEP00000002076	0.963	Membrane bound O-acyltransferase domain containing 1
9	61853.ENSNLEP00000008019	0.953	1-acylglycerol-3-phosphate O-acyltransferase 1
10	61853.ENSNLEP00000005155	0.929	Glycerol-3-phosphate dehydrogenase 1-like
11	61853.ENSNLEP00000021624	0.929	Glycerol-3-phosphate dehydrogenase 1 (soluble)
12	61853.ENSNLEP00000013523	0.920	Lysophosphatidylcholine acyltransferase 4
13	61853.ENSNLEP00000016033	0.913	Membrane bound O-acyltransferase domain containing 2
14	61853.ENSNLEP00000000847	0.908	Glycerol-3-phosphate dehydrogenase 2 (mitochondrial)
15	61853.ENSNLEP00000012329	0.908	Glycerol kinase
16	61853.ENSNLEP00000002801	0.904	Acylglycerol kinase
17	61853.ENSNLEP00000001787	0.902	Phospholipid phosphatase 1
18	61853.ENSNLEP00000012533	0.900	ADP-ribose/CDP-alcohol diphosphatase, manganese-dependent
19	61853.ENSNLEP00000006180	0.897	Lysophosphatidylcholine acyltransferase 3
20	61853.ENSNLEP00000007163	0.896	Abhydrolase domain containing 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004366	1.000	glycerol-3-phosphate O-acyltransferase activity
GO:0005515	0.998	protein binding
GO:0016411	0.996	acylglycerol O-acyltransferase activity
GO:0003841	0.994	1-acylglycerol-3-phosphate O-acyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044255	0.996	cellular lipid metabolic process
GO:0046486	0.989	glycerolipid metabolic process
GO:1901576	0.987	organic substance biosynthetic process
GO:0045017	0.979	glycerolipid biosynthetic process
GO:0006644	0.976	phospholipid metabolic process
GO:0090407	0.955	organophosphate biosynthetic process
GO:0006639	0.918	acylglycerol metabolic process
GO:0008654	0.891	phospholipid biosynthetic process
GO:0019432	0.855	triglyceride biosynthetic process
GO:0006650	0.605	glycerophospholipid metabolic process
GO:0046474	0.579	glycerophospholipid biosynthetic process
GO:0050789	0.457	regulation of biological process
GO:0006654	0.439	phosphatidic acid biosynthetic process
GO:0050794	0.434	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0016020	0.997	membrane
GO:0031090	0.971	organelle membrane
GO:0005789	0.963	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:15325	1.000	an acyl-CoA + sn-glycerol 3-phosphate = a 1-acyl-sn-glycero-3-phosphate + CoA
EC:2.3.1.15	1.000	glycerol-3-phosphate 1-O-acyltransferase.
RHEA:19709	0.994	a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA
EC:2.3.1.51	0.994	1-acylglycerol-3-phosphate O-acyltransferase.

[back to server]