StarFunc result for job id Q53FP2

User Input

>input (167 residues)
MASPRTVTIVALSVALGLFFVFMGTIKLTPRLSKDAYSEMKRAYKSYVRALPLLKKMGIN
SILLRKSIGALEVACGIVMTLVPGRPKDVANFFLLLLVLAVLFFHQLVGDPLKRYAHALV
FGILLTCRLLIARKPEDRSSEKKPLPGNAEEQPSLYEKAPQGKVKVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q53FP2	1.000	1.000	7.962E-23	167	1.000	1.000	Q53FP2.pdb.gz	NACHO_HUMAN Novel acetylcholine receptor chaperone OS=Homo sapiens OX=9606 GN=TMEM35A PE=1 SV=2
2	AFDB:Q920C4	0.331	0.273	7.559E-2	213	0.186	0.146	Q920C4.pdb.gz	MS4A3_MOUSE Membrane-spanning 4-domains subfamily A member 3 OS=Mus musculus OX=10090 GN=Ms4a3 PE=2 SV=1
3	AFDB:Q5W270	0.519	0.152	1.753E-1	670	0.156	0.039	Q5W270.pdb.gz	PIGB_SERS3 Oxidoreductase PigB OS=Serratia sp. (strain ATCC 39006) OX=104623 GN=pigB PE=3 SV=1
4	AFDB:Q500P4	0.202	0.119	2.737E-1	338	0.138	0.068	Q500P4.pdb.gz	Q500P4_PSEU2 Alginate regulatory protein AlgR3 OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=Psyr_0054 PE=4 SV=1
5	AFDB:P15276	0.151	0.084	3.022E-1	352	0.120	0.057	P15276.pdb.gz	ALGP_PSEAE Transcriptional regulatory protein AlgP OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=algP PE=4 SV=2
6	AFDB:Q96JA4	0.294	0.100	3.683E-1	679	0.156	0.038	Q96JA4.pdb.gz	M4A14_HUMAN Membrane-spanning 4-domains subfamily A member 14 OS=Homo sapiens OX=9606 GN=MS4A14 PE=1 SV=2
7	AFDB:Q5HYL7	0.364	0.345	4.273E-1	178	0.102	0.096	Q5HYL7.pdb.gz	TM196_HUMAN Transmembrane protein 196 OS=Homo sapiens OX=9606 GN=TMEM196 PE=1 SV=2
8	AFDB:Q09922	0.310	0.089	5.208E-1	782	0.150	0.032	Q09922.pdb.gz	YAKB_SCHPO Uncharacterized transcriptional regulatory protein C1F7.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1F7.11c PE=4 SV=1
9	AFDB:Q3YBM2	0.322	0.218	5.750E-1	270	0.162	0.100	Q3YBM2.pdb.gz	T176B_HUMAN Transmembrane protein 176B OS=Homo sapiens OX=9606 GN=TMEM176B PE=1 SV=2
10	AFDB:Q8SXA8	0.176	0.129	6.042E-1	237	0.144	0.101	Q8SXA8.pdb.gz	Q8SXA8_DROME GH18470p OS=Drosophila melanogaster OX=7227 GN=Msp300 PE=2 SV=1
11	PDB:7khro	0.238	0.248	6.473E-1	151	0.084	0.093	7khro.pdb.gz	Molecular basis of V-ATPase inhibition by bafilomycin A1.
12	PDB:2gs4A	0.243	0.251	7.890E-1	159	0.120	0.126	2gs4A.pdb.gz
13	PDB:6wv7B	0.290	0.163	9.153E-1	388	0.120	0.052	6wv7B.pdb.gz	Structural basis of antagonizing the vitamin K catalytic cycle for anticoagulation.
14	PDB:7u8gB	0.298	0.366	9.153E-1	132	0.108	0.136	7u8gB.pdb.gz	Structure of the core human NADPH oxidase NOX2.
15	PDB:7sk8A	0.201	0.128	1.062	306	0.102	0.056	7sk8A.pdb.gz	Structures of atypical chemokine receptor 3 reveal the basis for its promiscuity and signaling bias.
16	PDB:1b71A	0.165	0.149	1.294	191	0.084	0.073	1b71A.pdb.gz	Alternative metal-binding sites in rubrerythrin.
17	PDB:6jp5E	0.281	0.278	1.360	169	0.090	0.089	6jp5E.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
18	PDB:7sk7A	0.292	0.207	1.360	267	0.090	0.056	7sk7A.pdb.gz	Structures of atypical chemokine receptor 3 reveal the basis for its promiscuity and signaling bias.
19	PDB:4u14A	0.192	0.085	1.429	436	0.114	0.044	4u14A.pdb.gz	Modified T4 Lysozyme Fusion Proteins Facilitate G Protein-Coupled Receptor Crystallogenesis.
20	PDB:6wv9A	0.397	0.197	1.429	411	0.126	0.051	6wv9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q53FP2	1.00e-118	334	167	1.000	1.000	NACHO_HUMAN Novel acetylcholine receptor chaperone OS=Homo sapiens OX=9606 GN=TMEM35A PE=1 SV=2
2	Q6JAM9	1.54e-115	326	167	0.976	0.976	NACHO_RAT Novel acetylcholine receptor chaperone OS=Rattus norvegicus OX=10116 GN=Tmem35a PE=1 SV=1
3	Q9D328	4.68e-115	325	167	0.970	0.970	NACHO_MOUSE Novel acetylcholine receptor chaperone OS=Mus musculus OX=10090 GN=Tmem35a PE=1 SV=1
4	A2R7J4	0.54	32.7	411	0.180	0.073	A2R7J4_ASPNC cAMP-dependent protein kinase regulatory subunit OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=pkaR PE=3 SV=1
5	Q05899	0.75	31.2	129	0.216	0.279	YL297_YEAST Uncharacterized vacuolar protein YLR297W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YLR297W PE=1 SV=1
6	Q96UX3	2.0	30.8	413	0.186	0.075	KAPR_ASPFU cAMP-dependent protein kinase regulatory subunit OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=pkaR PE=3 SV=1
7	Q8LDU1	3.9	30.0	321	0.078	0.040	Q8LDU1_ARATH AT3G03890 protein OS=Arabidopsis thaliana OX=3702 GN=At3g03890 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05814 Ac76	7e+02	11.7	Orf76 (Ac76)
2	PF13564 DoxX_2	0.014	26.7	DoxX-like family
3	PF20087 DUF6479	5.2e+02	12.7	Family of unknown function (DUF6479)
4	PF13965 SID-1_RNA_chan	2.7e+02	11.4	dsRNA-gated channel SID-1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000009153

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000014265	0.734	SAS-6 centriolar assembly protein
2	61853.ENSNLEP00000016700	0.734	Centromere protein J
3	61853.ENSNLEP00000021265	0.697	RIC3 acetylcholine receptor chaperone
4	61853.ENSNLEP00000015869	0.639	Proline-rich nuclear receptor coactivator 1
5	61853.ENSNLEP00000017602	0.560	Alanine--glyoxylate aminotransferase 2
6	61853.ENSNLEP00000000862	0.546	Dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3
7	61853.ENSNLEP00000009449	0.546	Peptidyl arginine deiminase, type I
8	61853.ENSNLEP00000004912	0.524	Sperm associated antigen 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030548	1.000	acetylcholine receptor regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0048522	0.912	positive regulation of cellular process
GO:0060341	0.825	regulation of cellular localization
GO:0016043	0.818	cellular component organization
GO:2000008	0.818	regulation of protein localization to cell surface
GO:1903829	0.817	positive regulation of protein localization
GO:0043933	0.787	protein-containing complex organization
GO:0022607	0.775	cellular component assembly
GO:0065003	0.769	protein-containing complex assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]