StarFunc result for job id Q53FV1

User Input

>input (153 residues)
MNVGVAHSEVNPNTRVMNSRGIWLAYIILVGLLHMVLLSIPFFSIPVVWTLTNVIHNLAT
YVFLHTVKGTPFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSISPIVLYLLASFYTKYD
AAHFLINTASLLSVLLPKLPQFHGVRVFGINKY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q53FV1	1.000	1.000	1.509E-23	153	1.000	1.000	Q53FV1.pdb.gz	ORML2_HUMAN ORM1-like protein 2 OS=Homo sapiens OX=9606 GN=ORMDL2 PE=1 SV=2
2	AFDB:Q921I0	0.977	0.977	3.951E-21	153	0.817	0.817	Q921I0.pdb.gz	ORML1_MOUSE ORM1-like protein 1 OS=Mus musculus OX=10090 GN=Ormdl1 PE=2 SV=1
3	AFDB:A0A024R1W6	0.937	0.937	2.184E-19	153	0.810	0.810	A0A024R1W6.pdb.gz
4	PDB:7k0mD	0.932	0.932	9.635E-19	153	0.810	0.810	7k0mD.pdb.gz	Structural insights into the regulation of human serine palmitoyltransferase complexes.
5	AFDB:Q9VP04	0.919	0.913	3.692E-14	154	0.497	0.494	Q9VP04.pdb.gz	ORMDL_DROME ORM1-like protein OS=Drosophila melanogaster OX=7227 GN=ORMDL PE=2 SV=1
6	AFDB:O42901	0.899	0.744	9.192E-12	186	0.386	0.317	O42901.pdb.gz	YBA9_SCHPO Uncharacterized protein C119.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC119.09c PE=2 SV=3
7	AFDB:Q9C5I0	0.888	0.866	2.278E-10	157	0.386	0.376	Q9C5I0.pdb.gz	Q9C5I0_ARATH ORMDL family protein OS=Arabidopsis thaliana OX=3702 GN=ATORM1 PE=1 SV=1
8	AFDB:Q9FHY3	0.893	0.887	4.834E-10	154	0.379	0.377	Q9FHY3.pdb.gz	Q9FHY3_ARATH At5g42000 OS=Arabidopsis thaliana OX=3702 GN=ATORM2 PE=1 SV=1
9	AFDB:P53224	0.827	0.575	5.369E-9	222	0.314	0.216	P53224.pdb.gz	ORM1_YEAST Protein ORM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ORM1 PE=1 SV=1
10	AFDB:Q06144	0.787	0.565	1.399E-7	216	0.333	0.236	Q06144.pdb.gz	ORM2_YEAST Protein ORM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ORM2 PE=1 SV=1
11	AFDB:P97441	0.178	0.089	6.478E-1	388	0.176	0.070	P97441.pdb.gz	ZNT3_MOUSE Probable proton-coupled zinc antiporter SLC30A3 OS=Mus musculus OX=10090 GN=Slc30a3 PE=1 SV=1
12	PDB:6wvfA	0.254	0.135	1.048	386	0.105	0.041	6wvfA.pdb.gz	Termini restraining of small membrane proteins enables structure determination at near-atomic resolution.
13	PDB:5mg3D	0.296	0.144	2.223	414	0.111	0.041	5mg3D.pdb.gz
14	PDB:4rynA	0.254	0.252	3.004	154	0.118	0.117	4rynA.pdb.gz	Protein structure. Structure and activity of tryptophan-rich TSPO proteins.
15	PDB:5xtcr	0.181	0.078	3.492	459	0.157	0.052	5xtcr.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
16	PDB:6f5dL	0.131	0.123	3.492	165	0.072	0.067	6f5dL.pdb.gz	ATP synthase fromTrypanosoma bruceihas an elaborated canonical F1-domain and conventional catalytic sites.
17	PDB:5ogeG	0.261	0.157	3.672	306	0.111	0.056	5ogeG.pdb.gz
18	PDB:6ylgt	0.262	0.130	3.672	431	0.105	0.037	6ylgt.pdb.gz	Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
19	PDB:4nq0A	0.183	0.133	4.487	254	0.111	0.067	4nq0A.pdb.gz
20	PDB:6nsmA	0.236	0.199	4.487	194	0.137	0.108	6nsmA.pdb.gz	Structures of TetR family transcriptional regulator CifR_C99T-C181R Cysteines mutant complexed with 26bp double-strand operator DNA

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q53FV1	2.57e-110	311	153	1.000	1.000	ORML2_HUMAN ORM1-like protein 2 OS=Homo sapiens OX=9606 GN=ORMDL2 PE=1 SV=2
2	Q9P0S3	5.81e-96	275	153	0.830	0.830	ORML1_HUMAN ORM1-like protein 1 OS=Homo sapiens OX=9606 GN=ORMDL1 PE=1 SV=1
3	Q9CPZ6	2.01e-95	274	153	0.810	0.810	ORML3_MOUSE ORM1-like protein 3 OS=Mus musculus OX=10090 GN=Ormdl3 PE=2 SV=1
4	Q8N138	2.31e-95	273	153	0.810	0.810	ORML3_HUMAN ORM1-like protein 3 OS=Homo sapiens OX=9606 GN=ORMDL3 PE=1 SV=1
5	Q921I0	1.53e-94	271	153	0.817	0.817	ORML1_MOUSE ORM1-like protein 1 OS=Mus musculus OX=10090 GN=Ormdl1 PE=2 SV=1
6	F8VXD5	1.51e-83	243	119	0.778	1.000	F8VXD5_HUMAN ORMDL sphingolipid biosynthesis regulator 2 OS=Homo sapiens OX=9606 GN=ORMDL2 PE=1 SV=1
7	J3QRM9	1.38e-78	230	129	0.680	0.806	J3QRM9_HUMAN ORMDL sphingolipid biosynthesis regulator 3 (Fragment) OS=Homo sapiens OX=9606 GN=ORMDL3 PE=1 SV=1
8	A0A1B0GXE7	8.41e-67	200	109	0.601	0.844	A0A1B0GXE7_HUMAN ORMDL sphingolipid biosynthesis regulator 1 OS=Homo sapiens OX=9606 GN=ORMDL1 PE=1 SV=1
9	F6WST4	3.24e-66	198	108	0.595	0.843	F6WST4_HUMAN ORMDL sphingolipid biosynthesis regulator 1 (Fragment) OS=Homo sapiens OX=9606 GN=ORMDL1 PE=1 SV=7
10	Q9VP04	7.39e-51	161	154	0.497	0.494	ORMDL_DROME ORM1-like protein OS=Drosophila melanogaster OX=7227 GN=ORMDL PE=2 SV=1
11	O42901	5.32e-35	122	186	0.392	0.323	YBA9_SCHPO Uncharacterized protein C119.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC119.09c PE=2 SV=3
12	Q9C5I0	1.98e-31	112	157	0.392	0.382	Q9C5I0_ARATH ORMDL family protein OS=Arabidopsis thaliana OX=3702 GN=ATORM1 PE=1 SV=1
13	Q9FHY3	1.24e-30	110	154	0.379	0.377	Q9FHY3_ARATH At5g42000 OS=Arabidopsis thaliana OX=3702 GN=ATORM2 PE=1 SV=1
14	Q06144	9.69e-19	80.9	216	0.359	0.255	ORM2_YEAST Protein ORM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ORM2 PE=1 SV=1
15	P53224	2.05e-17	77.8	222	0.320	0.221	ORM1_YEAST Protein ORM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ORM1 PE=1 SV=1
16	F4JHZ4	0.35	33.1	1031	0.183	0.027	F4JHZ4_ARATH Glycosyl transferase family 1 protein OS=Arabidopsis thaliana OX=3702 GN=At4g01210 PE=1 SV=1
17	R4GER2	6.9	29.3	485	0.092	0.029	ATG4D_DANRE Cysteine protease atg4da OS=Danio rerio OX=7955 GN=atg4da PE=3 SV=1
18	Q7Z4L4	7.9	28.9	538	0.092	0.026	Q7Z4L4_HUMAN TNIK protein OS=Homo sapiens OX=9606 GN=TNIK PE=2 SV=1
19	Q9UKE5	8.7	28.9	1360	0.092	0.010	TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens OX=9606 GN=TNIK PE=1 SV=1
20	D3ZZQ0	9.1	28.9	1260	0.092	0.011	D3ZZQ0_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04061 ORMDL	1.2e-49	179.1	ORMDL family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000243045

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000394936	0.931	Alpha-1-acid glycoprotein 2
2	9606.ENSP00000259396	0.925	Alpha-1-acid glycoprotein 1
3	9606.ENSP00000262554	0.900	Serine palmitoyltransferase 1
4	9606.ENSP00000216484	0.850	Serine palmitoyltransferase 2
5	9606.ENSP00000381968	0.841	Serine palmitoyltransferase 3
6	9606.ENSP00000298130	0.818	Serine palmitoyltransferase small subunit A
7	9606.ENSP00000359634	0.787	Golgin subfamily A member 7B
8	9606.ENSP00000352097	0.767	Serine palmitoyltransferase small subunit B
9	9606.ENSP00000349689	0.652	Palmitoyltransferase ZDHHC9
10	9606.ENSP00000326869	0.557	ORM1-like protein 1
11	9606.ENSP00000350378	0.550	Golgin subfamily A member 7
12	9606.ENSP00000377724	0.547	ORM1-like protein 3
13	9606.ENSP00000271688	0.519	Ceramide synthase 2
14	9606.ENSP00000329210	0.518	Olfactory receptor 2T10
15	9606.ENSP00000341581	0.517	Olfactory receptor 52B6
16	9606.ENSP00000306607	0.505	Olfactory receptor 1L8
17	9606.ENSP00000334934	0.504	Olfactory receptor 9Q1
18	9606.ENSP00000407653	0.504	Proline-rich protein 22
19	9606.ENSP00000325485	0.501	Ceramide synthase 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.990	primary metabolic process
GO:0044237	0.990	cellular metabolic process
GO:1901564	0.988	organonitrogen compound metabolic process
GO:0034248	0.985	regulation of amide metabolic process
GO:0044087	0.982	regulation of cellular component biogenesis
GO:0046890	0.982	regulation of lipid biosynthetic process
GO:0044255	0.980	cellular lipid metabolic process
GO:0006665	0.971	sphingolipid metabolic process
GO:0043603	0.966	amide metabolic process
GO:0031323	0.961	regulation of cellular metabolic process
GO:0006672	0.951	ceramide metabolic process
GO:0045833	0.924	negative regulation of lipid metabolic process
GO:0060255	0.919	regulation of macromolecule metabolic process
GO:0031326	0.908	regulation of cellular biosynthetic process
GO:0010556	0.866	regulation of macromolecule biosynthetic process
GO:0051055	0.829	negative regulation of lipid biosynthetic process
GO:0034249	0.822	negative regulation of amide metabolic process
GO:0048523	0.638	negative regulation of cellular process
GO:0031324	0.622	negative regulation of cellular metabolic process
GO:0044249	0.558	cellular biosynthetic process
GO:0031327	0.545	negative regulation of cellular biosynthetic process
GO:1901576	0.514	organic substance biosynthetic process
GO:1901566	0.486	organonitrogen compound biosynthetic process
GO:0034641	0.360	cellular nitrogen compound metabolic process
GO:0044271	0.353	cellular nitrogen compound biosynthetic process
GO:0046467	0.332	membrane lipid biosynthetic process
GO:0030148	0.316	sphingolipid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.999	endoplasmic reticulum
GO:0016020	0.955	membrane
GO:0031090	0.897	organelle membrane
GO:0005789	0.722	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]