StarFunc result for job id Q53FZ2

User Input

>input (586 residues)
MLARVTRKMLRHAKCFQRLAIFGSVRALHKDNRTATPQNFSNYESMKQDFKLGIPEYFNF
AKDVLDQWTDKEKAGKKPSNPAFWWINRNGEEMRWSFEELGSLSRKFANILSEACSLQRG
DRVILILPRVPEWWLANVACLRTGTVLIPGTTQLTQKDILYRLQSSKANCIITNDVLAPA
VDAVASKCENLHSKLIVSENSREGWGNLKELMKHASDSHTCVKTKHNEIMAIFFTSGTSG
YPKMTAHTHSSFGLGLSVNGRFWLDLTPSDVMWNTSDTGWAKSAWSSVFSPWIQGACVFT
HHLPRFEPTSILQTLSKYPITVFCSAPTVYRMLVQNDITSYKFKSLKHCVSAGEPITPDV
TEKWRNKTGLDIYEGYGQTETVLICGNFKGMKIKPGSMGKPSPAFDVKIVDVNGNVLPPG
QEGDIGIQVLPNRPFGLFTHYVDNPSKTASTLRGNFYITGDRGYMDKDGYFWFVARADDV
ILSSGYRIGPFEVENALNEHPSVAESAVVSSPDPIRGEVVKAFVVLNPDYKSHDQEQLIK
EIQEHVKKTTAPYKYPRKVEFIQELPKTISGKTKRNELRKKEWKTI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3UNX5	0.784	0.792	0.000	580	0.850	0.859	Q3UNX5.pdb.gz	ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus OX=10090 GN=Acsm3 PE=1 SV=2
2	AFDB:Q53FZ2	1.000	1.000	0.000	586	1.000	1.000	Q53FZ2.pdb.gz	ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM3 PE=1 SV=2
3	AFDB:Q7TN78	0.908	0.917	1.165E-91	580	0.587	0.593	Q7TN78.pdb.gz	ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acsm4 PE=1 SV=1
4	AFDB:Q9BEA2	0.896	0.910	4.710E-87	577	0.534	0.542	Q9BEA2.pdb.gz	ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus OX=9913 GN=ACSM1 PE=1 SV=2
5	AFDB:Q8K0L3	0.736	0.750	2.557E-82	575	0.514	0.523	Q8K0L3.pdb.gz	ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus OX=10090 GN=Acsm2 PE=1 SV=1
6	AFDB:Q08AH3	0.734	0.746	3.051E-82	577	0.529	0.537	Q08AH3.pdb.gz	ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM2A PE=1 SV=2
7	AFDB:Q91VA0	0.737	0.753	3.051E-82	573	0.498	0.510	Q91VA0.pdb.gz	ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus OX=10090 GN=Acsm1 PE=1 SV=1
8	AFDB:Q08AH1	0.740	0.751	5.834E-82	577	0.524	0.532	Q08AH1.pdb.gz	ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM1 PE=1 SV=1
9	PDB:3b7wA	0.733	0.799	7.238E-81	537	0.527	0.575	3b7wA.pdb.gz	Structural snapshots for the conformation-dependent catalysis by human medium-chain acyl-coenzyme A synthetase ACSM2A.
10	AFDB:Q729U8	0.894	0.950	1.508E-69	551	0.392	0.417	Q729U8.pdb.gz	Q729U8_DESVH AMP-binding protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_2250 PE=1 SV=1
11	AFDB:A4YDT1	0.851	0.883	2.066E-60	564	0.353	0.367	A4YDT1.pdb.gz	HBCL1_METS5 4-hydroxybutyrate--CoA ligase 1 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_0406 PE=1 SV=1
12	PDB:2p20A	0.687	0.631	1.922E-47	641	0.258	0.236	2p20A.pdb.gz	Biochemical and Crystallographic Analysis of Substrate Binding and Conformational Changes in Acetyl-CoA Synthetase.
13	PDB:1ry2A	0.817	0.780	5.211E-46	615	0.237	0.226	1ry2A.pdb.gz	Crystal structure of yeast acetyl-coenzyme A synthetase in complex with AMP
14	PDB:5bsmA	0.793	0.872	9.879E-44	530	0.230	0.255	5bsmA.pdb.gz	Structural Basis for Specificity and Flexibility in a Plant 4-Coumarate:CoA Ligase.
15	PDB:6q2mA	0.806	0.865	1.111E-43	544	0.213	0.230	6q2mA.pdb.gz	Mutagenesis and Structural Studies Reveal the Basis for the Activity and Stability Properties That Distinguish thePhotinusLuciferasesscintillansandpyralis.
16	PDB:5ie2A	0.748	0.860	5.144E-43	506	0.206	0.239	5ie2A.pdb.gz	Crystal Structures of Arabidopsis thaliana Oxalyl-CoA Synthetase Essential for Oxalate Degradation
17	PDB:1ultA	0.680	0.742	3.183E-41	533	0.220	0.242	1ultA.pdb.gz
18	PDB:3r44A	0.656	0.756	9.751E-41	502	0.203	0.237	3r44A.pdb.gz	The Mycobacterium tuberculosis Very-Long-Chain Fatty Acyl-CoA Synthetase: Structural Basis for Housing Lipid Substrates Longer than the Enzyme.
19	PDB:7kydA	0.776	0.848	2.988E-40	534	0.222	0.243	7kydA.pdb.gz	FruitFire: a luciferase based on a fruit fly metabolic enzyme.
20	PDB:3rg2C	0.642	0.615	4.990E-36	613	0.196	0.188	3rg2C.pdb.gz	Structural and Functional Investigation of the Intermolecular Interaction between NRPS Adenylation and Carrier Protein Domains.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q08AH1	0.0	635	577	0.510	0.518	ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM1 PE=1 SV=1
2	Q08AH3	0.0	663	577	0.534	0.542	ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM2A PE=1 SV=2
3	Q3UNX5	0.0	1068	580	0.853	0.862	ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus OX=10090 GN=Acsm3 PE=1 SV=2
4	Q53FZ2	0.0	1225	586	1.000	1.000	ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM3 PE=1 SV=2
5	Q68CK6	0.0	657	577	0.527	0.536	ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM2B PE=1 SV=2
6	Q7TN78	0.0	758	580	0.584	0.590	ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acsm4 PE=1 SV=1
7	Q80W40	0.0	757	580	0.582	0.588	ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus OX=10090 GN=Acsm4 PE=2 SV=1
8	Q8K0L3	0.0	655	575	0.519	0.529	ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus OX=10090 GN=Acsm2 PE=1 SV=1
9	Q91VA0	0.0	619	573	0.490	0.501	ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus OX=10090 GN=Acsm1 PE=1 SV=1
10	Q9BEA2	0.0	664	577	0.517	0.525	ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus OX=9913 GN=ACSM1 PE=1 SV=2
11	Q729U8	7.95e-154	454	551	0.401	0.426	Q729U8_DESVH AMP-binding protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_2250 PE=1 SV=1
12	A4YDT1	1.24e-113	352	564	0.358	0.372	HBCL1_METS5 4-hydroxybutyrate--CoA ligase 1 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_0406 PE=1 SV=1
13	Q726Y7	5.47e-67	232	661	0.288	0.256	Q726Y7_DESVH Acetyl-coenzyme A synthetase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=acsA PE=1 SV=1
14	P27550	6.38e-57	204	652	0.270	0.242	ACSA_ECOLI Acetyl-coenzyme A synthetase OS=Escherichia coli (strain K12) OX=83333 GN=acs PE=1 SV=2
15	P9WQD1	3.53e-55	199	651	0.285	0.257	ACSA_MYCTU Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=acsA PE=1 SV=1
16	D3ZZN3	7.12e-54	196	682	0.280	0.240	D3ZZN3_RAT Acetyl-coenzyme A synthetase OS=Rattus norvegicus OX=10116 GN=Acss1 PE=3 SV=1
17	Q8ZKF6	1.94e-53	194	652	0.268	0.241	ACSA_SALTY Acetyl-coenzyme A synthetase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=acs PE=1 SV=1
18	Q99NB1	1.48e-52	192	682	0.273	0.235	ACS2L_MOUSE Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Mus musculus OX=10090 GN=Acss1 PE=1 SV=1
19	A4YGR1	2.52e-50	186	661	0.273	0.242	HPCAS_METS5 3-hydroxypropionyl-coenzyme A synthetase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_1456 PE=1 SV=1
20	Q5E268	1.26e-49	184	649	0.259	0.234	Q5E268_ALIF1 Acetyl-coenzyme A synthetase OS=Aliivibrio fischeri (strain ATCC 700601 / ES114) OX=312309 GN=acs PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00501 AMP-binding	3.2e-74	261.7	AMP-binding enzyme
2	PF13193 AMP-binding_C	2e-20	84.8	AMP-binding enzyme C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000289416

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000242592	0.940	Short-chain specific acyl-CoA dehydrogenase, mitochondrial
2	9606.ENSP00000278840	0.902	Fatty acid desaturase 2
3	9606.ENSP00000287275	0.724	Glycine N-acyltransferase-like protein 2
4	9606.ENSP00000383900	0.712	Lipase member K
5	9606.ENSP00000037869	0.708	Protein FAM136A
6	9606.ENSP00000286918	0.701	Ankyrin repeat domain-containing protein 9
7	9606.ENSP00000399938	0.695	FLYWCH-type zinc finger 1
8	9606.ENSP00000483507	0.694	Hydroxyacid oxidase 2
9	9606.ENSP00000302620	0.691	Alanine-glyoxylate aminotransferase
10	9606.ENSP00000258787	0.681	Unconventional myosin-Ig
11	9606.ENSP00000309141	0.674	E3 ubiquitin-protein ligase MARCH3
12	9606.ENSP00000364678	0.660	Histone-lysine N-methyltransferase EHMT2
13	9606.ENSP00000323816	0.654	Aryl hydrocarbon receptor repressor
14	9606.ENSP00000297524	0.637	Solute carrier family 7 member 13
15	9606.ENSP00000340982	0.622	Sperm-associated antigen 8
16	9606.ENSP00000378230	0.610	ATP-binding cassette sub-family C member 11
17	9606.ENSP00000360147	0.603	Xaa-Pro aminopeptidase 2
18	9606.ENSP00000265605	0.599	Aldehyde dehydrogenase family 8 member A1
19	9606.ENSP00000378868	0.594	APOBEC1 complementation factor
20	9606.ENSP00000323568	0.570	Solute carrier family 2, facilitated glucose transporter member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016878	1.000	acid-thiol ligase activity
GO:0016405	1.000	CoA-ligase activity
GO:0015645	0.867	fatty acid ligase activity
GO:0005515	0.845	protein binding
GO:0004467	0.321	long-chain fatty acid-CoA ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.988	organic substance metabolic process
GO:0009987	0.986	cellular process
GO:0044237	0.983	cellular metabolic process
GO:0044238	0.979	primary metabolic process
GO:0044281	0.838	small molecule metabolic process
GO:0065007	0.836	biological regulation
GO:0032501	0.827	multicellular organismal process
GO:0003013	0.720	circulatory system process
GO:0065008	0.648	regulation of biological quality
GO:0008217	0.638	regulation of blood pressure
GO:0043436	0.495	oxoacid metabolic process
GO:0006629	0.493	lipid metabolic process
GO:0019752	0.491	carboxylic acid metabolic process
GO:0006631	0.474	fatty acid metabolic process
GO:0009058	0.388	biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.997	mitochondrion
GO:0070013	0.937	intracellular organelle lumen
GO:0005759	0.330	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.2.1.-	1.000	Acid--thiol ligases.
RHEA:15421	0.321	a long-chain fatty acid + ATP + CoA = a long-chain fatty acyl-CoA + AMP + diphosphate
EC:6.2.1.3	0.321	long-chain-fatty-acid--CoA ligase.

[back to server]