StarFunc result for job id Q53GL7

User Input

>input (1025 residues)
MVAMAEAEAGVAVEVRGLPPAVPDELLTLYFENRRRSGGGPVLSWQRLGCGGVLTFREPA
DAERVLAQADHELHGAQLSLRPAPPRAPARLLLQGLPPGTTPQRLEQHVQALLRASGLPV
QPCCALASPRPDRALVQLPKPLSEADVRVLEEQAQNLGLEGTLVSLARVPQARAVRVVGD
GASVDLLLLELYLENERRSGGGPLEDLQRLPGPLGTVASFQQWQVAERVLQQEHRLQGSE
LSLVPHYDILEPEELAENTSGGDHPSTQGPRATKHALLRTGGLVTALQGAGTVTMGSGEE
PGQSGASLRTGPMVQGRGIMTTGSGQEPGQSGTSLRTGPMGSLGQAEQVSSMPMGSLEHE
GLVSLRPVGLQEQEGPMSLGPVGSAGPVETSKGLLGQEGLVEIAMDSPEQEGLVGPMEIT
MGSLEKAGPVSPGCVKLAGQEGLVEMVLLMEPGAMRFLQLYHEDLLAGLGDVALLPLEGP
DMTGFRLCGAQASCQAAEEFLRSLLGSISCHVLCLEHPGSARFLLGPEGQHLLQGLEAQF
QCVFGTERLATATLDTGLEEVDPTEALPVLPGNAHTLWTPDSTGGDQEDVSLEEVRELLA
TLEGLDLDGEDWLPRELEEEGPQEQPEEEVTPGHEEEEPVAPSTVAPRWLEEEAALQLAL
HRSLEPQGQVAEQEEAAALRQALTLSLLEQPPLEAEEPPDGGTDGKAQLVVHSAFEQDVE
ELDRALRAALEVHVQEETVGPWRRTLPAELRARLERCHGVSVALRGDCTILRGFGAHPAR
AARHLVALLAGPWDQSLAFPLAASGPTLAGQTLKGPWNNLERLAENTGEFQEVVRAFYDT
LDAARSSIRVVRVERVSHPLLQQQYELYRERLLQRCERRPVEQVLYHGTTAPAVPDICAH
GFNRSFCGRNATVYGKGVYFARRASLSVQDRYSPPNADGHKAVFVARVLTGDYGQGRRGL
RAPPLRGPGHVLLRYDSAVDCICQPSIFVIFHDTQALPTHLITCEHVPRASPDDPSGLPG
RSPDT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PNI7	0.474	0.469	0.000	1037	0.999	0.987	E9PNI7.pdb.gz	E9PNI7_HUMAN Poly [ADP-ribose] polymerase OS=Homo sapiens OX=9606 GN=PARP10 PE=1 SV=1
2	AFDB:Q2EMV9	0.177	0.102	1.267E-25	1817	0.204	0.115	Q2EMV9.pdb.gz	PAR14_MOUSE Protein mono-ADP-ribosyltransferase PARP14 OS=Mus musculus OX=10090 GN=Parp14 PE=1 SV=3
3	AFDB:Q460N5	0.177	0.103	1.761E-25	1801	0.200	0.114	Q460N5.pdb.gz	PAR14_HUMAN Protein mono-ADP-ribosyltransferase PARP14 OS=Homo sapiens OX=9606 GN=PARP14 PE=1 SV=3
4	AFDB:Q460N3	0.178	0.267	6.623E-19	678	0.070	0.106	Q460N3.pdb.gz	PAR15_HUMAN Protein mono-ADP-ribosyltransferase PARP15 OS=Homo sapiens OX=9606 GN=PARP15 PE=1 SV=2
5	PDB:5vsuA	0.090	0.207	1.214E-9	387	0.044	0.116	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
6	AFDB:Q8W569	0.097	0.169	5.103E-9	455	0.068	0.154	Q8W569.pdb.gz	Q8W569_ARATH AT4g26650/T15N24_100 OS=Arabidopsis thaliana OX=3702 GN=At4g26650 PE=1 SV=1
7	PDB:6x0lP	0.132	0.274	6.648E-9	474	0.031	0.068	6x0lP.pdb.gz	Bridging of DNA breaks activates PARP2-HPF1 to modify chromatin.
8	AFDB:F4JFN7	0.074	0.149	1.041E-8	495	0.080	0.166	F4JFN7.pdb.gz	F4JFN7_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=At3g07810 PE=1 SV=1
9	AFDB:F4JYK6	0.089	0.164	1.229E-7	453	0.082	0.185	F4JYK6.pdb.gz	F4JYK6_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=MNJ7.21 PE=1 SV=1
10	AFDB:A0A0S2Z4Z0	0.095	0.136	1.708E-7	669	0.100	0.154	A0A0S2Z4Z0.pdb.gz	A0A0S2Z4Z0_HUMAN RNA binding motif protein 14 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RBM14 PE=2 SV=1
11	AFDB:Q9SJG8	0.078	0.091	2.803E-6	843	0.094	0.114	Q9SJG8.pdb.gz	AML2_ARATH Protein MEI2-like 2 OS=Arabidopsis thaliana OX=3702 GN=ML2 PE=2 SV=2
12	PDB:6y53o	0.066	0.392	3.651E-6	160	0.027	0.175	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
13	AFDB:Q6DRJ8	0.086	0.125	4.592E-6	667	0.056	0.085	Q6DRJ8.pdb.gz
14	PDB:6y5qq	0.065	0.336	2.779E-5	178	0.025	0.146	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
15	PDB:5lsbA	0.071	0.358	3.101E-5	176	0.022	0.131	5lsbA.pdb.gz
16	PDB:7oqcF	0.070	0.242	1.157E-4	267	0.033	0.127	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
17	PDB:7evoD	0.067	0.316	1.608E-4	200	0.031	0.160	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
18	PDB:6r5kH	0.066	0.159	2.940E-4	394	0.042	0.109	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
19	PDB:5it0A	0.074	0.148	1.797E-3	396	0.035	0.091	5it0A.pdb.gz	SAD phasing using iodide ions in a high-throughput structural genomics environment.
20	PDB:6ff7X	0.071	0.362	2.497E-3	171	0.021	0.129	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PK67	0.0	2001	1016	0.991	1.000	E9PK67_HUMAN Poly [ADP-ribose] polymerase OS=Homo sapiens OX=9606 GN=PARP10 PE=1 SV=1
2	E9PNI7	0.0	2021	1037	0.999	0.987	E9PNI7_HUMAN Poly [ADP-ribose] polymerase OS=Homo sapiens OX=9606 GN=PARP10 PE=1 SV=1
3	Q53GL7	0.0	2024	1025	1.000	1.000	PAR10_HUMAN Protein mono-ADP-ribosyltransferase PARP10 OS=Homo sapiens OX=9606 GN=PARP10 PE=1 SV=2
4	Q2EMV9	3.54e-36	151	1817	0.069	0.039	PAR14_MOUSE Protein mono-ADP-ribosyltransferase PARP14 OS=Mus musculus OX=10090 GN=Parp14 PE=1 SV=3
5	Q460N3	9.58e-35	144	678	0.065	0.099	PAR15_HUMAN Protein mono-ADP-ribosyltransferase PARP15 OS=Homo sapiens OX=9606 GN=PARP15 PE=1 SV=2
6	Q460N5	1.25e-33	143	1801	0.068	0.039	PAR14_HUMAN Protein mono-ADP-ribosyltransferase PARP14 OS=Homo sapiens OX=9606 GN=PARP14 PE=1 SV=3
7	Q05BQ2	5.98e-27	120	660	0.063	0.098	Q05BQ2_HUMAN TIPARP protein (Fragment) OS=Homo sapiens OX=9606 GN=TIPARP PE=2 SV=1
8	Q7Z3E1	8.46e-27	119	657	0.063	0.099	PARPT_HUMAN Protein mono-ADP-ribosyltransferase TIPARP OS=Homo sapiens OX=9606 GN=TIPARP PE=1 SV=1
9	Q8C1B2	8.54e-27	119	657	0.063	0.099	PARPT_MOUSE Protein mono-ADP-ribosyltransferase TIPARP OS=Mus musculus OX=10090 GN=Tiparp PE=2 SV=1
10	D3ZMH5	9.00e-27	119	657	0.063	0.099	D3ZMH5_RAT TCDD-inducible poly(ADP-ribose) polymerase OS=Rattus norvegicus OX=10116 GN=Tiparp PE=3 SV=1
11	A0A8I6GA83	9.10e-27	119	688	0.063	0.094	A0A8I6GA83_RAT TCDD-inducible poly(ADP-ribose) polymerase OS=Rattus norvegicus OX=10116 GN=Tiparp PE=3 SV=1
12	F1N973	5.23e-26	117	670	0.061	0.094	F1N973_CHICK TCDD inducible poly(ADP-ribose) polymerase OS=Gallus gallus OX=9031 GN=TIPARP PE=3 SV=2
13	A0A0R4IVH6	3.14e-25	114	646	0.063	0.101	A0A0R4IVH6_DANRE TCDD-inducible poly [ADP-ribose] polymerase OS=Danio rerio OX=7955 GN=fc03g05 PE=3 SV=1
14	Q9H0J9	2.78e-20	99.0	701	0.062	0.091	PAR12_HUMAN Protein mono-ADP-ribosyltransferase PARP12 OS=Homo sapiens OX=9606 GN=PARP12 PE=1 SV=1
15	Q8CFF0	2.93e-20	95.5	331	0.067	0.208	PAR11_MOUSE Protein mono-ADP-ribosyltransferase PARP11 OS=Mus musculus OX=10090 GN=Parp11 PE=2 SV=1
16	Q9NR21	5.48e-20	94.7	338	0.066	0.201	PAR11_HUMAN Protein mono-ADP-ribosyltransferase PARP11 OS=Homo sapiens OX=9606 GN=PARP11 PE=1 SV=2
17	G5E9U8	1.54e-15	82.4	399	0.050	0.128	G5E9U8_HUMAN Poly (ADP-ribose) polymerase family, member 9, isoform CRA_b OS=Homo sapiens OX=9606 GN=PARP9 PE=1 SV=1
18	Q8IXQ6	3.36e-15	82.8	854	0.050	0.060	PARP9_HUMAN Protein mono-ADP-ribosyltransferase PARP9 OS=Homo sapiens OX=9606 GN=PARP9 PE=1 SV=2
19	Q8CAS9	2.53e-13	77.0	866	0.044	0.052	PARP9_MOUSE Protein mono-ADP-ribosyltransferase PARP9 OS=Mus musculus OX=10090 GN=Parp9 PE=1 SV=2
20	C9J6P4	3.50e-12	73.2	1024	0.041	0.041	C9J6P4_HUMAN Zinc finger CCCH-type containing, antiviral 1 OS=Homo sapiens OX=9606 GN=ZC3HAV1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00644 PARP	1.3e-24	98.3	Poly(ADP-ribose) polymerase catalytic domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000325618

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000479618	0.953	Myc proto-oncogene protein
2	9606.ENSP00000261888	0.771	Mono [ADP-ribose] polymerase PARP16
3	9606.ENSP00000381740	0.758	Poly [ADP-ribose] polymerase 3
4	9606.ENSP00000217246	0.750	O-acetyl-ADP-ribose deacetylase MACROD2
5	9606.ENSP00000323856	0.748	Plectin
6	9606.ENSP00000371419	0.738	poly(ADP-ribose) polymerase family member 4
7	9606.ENSP00000420484	0.735	O-acetyl-ADP-ribose deacetylase 1
8	9606.ENSP00000360689	0.703	Tankyrase-2
9	9606.ENSP00000484669	0.696	Cleavage and polyadenylation specificity factor subunit 1
10	9606.ENSP00000250416	0.695	Poly [ADP-ribose] polymerase 2
11	9606.ENSP00000456348	0.692	poly(ADP-ribose) polymerase family member 6
12	9606.ENSP00000281631	0.689	poly(ADP-ribose) polymerase family member 8
13	9606.ENSP00000355759	0.688	Poly [ADP-ribose] polymerase 1
14	9606.ENSP00000255681	0.686	O-acetyl-ADP-ribose deacetylase MACROD1
15	9606.ENSP00000311579	0.677	Tankyrase-1
16	9606.ENSP00000378760	0.664	Major vault protein
17	9606.ENSP00000384408	0.662	Poly(ADP-ribose) glycohydrolase
18	9606.ENSP00000338191	0.647	Beta-2-syntrophin
19	9606.ENSP00000260665	0.641	Leucine-rich PPR motif-containing protein, mitochondrial
20	9606.ENSP00000418194	0.631	Poly [ADP-ribose] polymerase 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003950	0.999	NAD+ ADP-ribosyltransferase activity
GO:1990404	0.999	NAD+-protein ADP-ribosyltransferase activity
GO:0070530	0.992	K63-linked polyubiquitin modification-dependent protein binding
GO:1901363	0.945	heterocyclic compound binding
GO:0097159	0.937	organic cyclic compound binding
GO:0008134	0.894	transcription factor binding
GO:0003676	0.762	nucleic acid binding
GO:0140297	0.516	DNA-binding transcription factor binding
GO:0003723	0.470	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0044238	0.995	primary metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0006950	0.993	response to stress
GO:0051716	0.993	cellular response to stimulus
GO:0006139	0.993	nucleobase-containing compound metabolic process
GO:0051171	0.992	regulation of nitrogen compound metabolic process
GO:1901564	0.991	organonitrogen compound metabolic process
GO:0050794	0.986	regulation of cellular process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0048519	0.975	negative regulation of biological process
GO:0010468	0.961	regulation of gene expression
GO:0009892	0.936	negative regulation of metabolic process
GO:0080090	0.934	regulation of primary metabolic process
GO:0006974	0.878	cellular response to DNA damage stimulus
GO:0043412	0.869	macromolecule modification
GO:0010605	0.864	negative regulation of macromolecule metabolic process
GO:0036211	0.863	protein modification process
GO:0048523	0.853	negative regulation of cellular process
GO:0031323	0.841	regulation of cellular metabolic process
GO:0065009	0.727	regulation of molecular function
GO:0019219	0.718	regulation of nucleobase-containing compound metabolic process
GO:0071840	0.705	cellular component organization or biogenesis
GO:0016043	0.696	cellular component organization
GO:0051172	0.692	negative regulation of nitrogen compound metabolic process
GO:0090304	0.655	nucleic acid metabolic process
GO:0044260	0.651	cellular macromolecule metabolic process
GO:0031326	0.611	regulation of cellular biosynthetic process
GO:0006796	0.609	phosphate-containing compound metabolic process
GO:0051246	0.607	regulation of protein metabolic process
GO:0072524	0.585	pyridine-containing compound metabolic process
GO:0010556	0.551	regulation of macromolecule biosynthetic process
GO:0006281	0.543	DNA repair
GO:0055086	0.527	nucleobase-containing small molecule metabolic process
GO:0009117	0.519	nucleotide metabolic process
GO:0072521	0.509	purine-containing compound metabolic process
GO:0044271	0.474	cellular nitrogen compound biosynthetic process
GO:1901362	0.467	organic cyclic compound biosynthetic process
GO:0019438	0.465	aromatic compound biosynthetic process
GO:0018130	0.465	heterocycle biosynthetic process
GO:0031399	0.458	regulation of protein modification process
GO:0034654	0.458	nucleobase-containing compound biosynthetic process
GO:0051252	0.457	regulation of RNA metabolic process
GO:0044092	0.446	negative regulation of molecular function
GO:0048518	0.445	positive regulation of biological process
GO:0006355	0.436	regulation of DNA-templated transcription
GO:0072525	0.435	pyridine-containing compound biosynthetic process
GO:0046496	0.435	nicotinamide nucleotide metabolic process
GO:0051248	0.434	negative regulation of protein metabolic process
GO:0019674	0.434	NAD metabolic process
GO:0010629	0.423	negative regulation of gene expression
GO:0031400	0.417	negative regulation of protein modification process
GO:1901293	0.415	nucleoside phosphate biosynthetic process
GO:0043687	0.407	post-translational protein modification
GO:0019359	0.406	nicotinamide nucleotide biosynthetic process
GO:0006164	0.403	purine nucleotide biosynthetic process
GO:0009435	0.392	NAD biosynthetic process
GO:0019080	0.362	viral gene expression
GO:0043433	0.362	negative regulation of DNA-binding transcription factor activity
GO:0071897	0.324	DNA biosynthetic process
GO:1903320	0.312	regulation of protein modification by small protein conjugation or removal

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005794	1.000	Golgi apparatus
GO:0005730	1.000	nucleolus
GO:0005654	0.770	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.2.30	0.999	NAD(+) ADP-ribosyltransferase.

[back to server]