StarFunc result for job id Q53GQ0

User Input

>input (312 residues)
MESALPAAGFLYWVGAGTVAYLALRISYSLFTALRVWGVGNEAGVGPGLGEWAVVTGSTD
GIGKSYAEELAKHGMKVVLISRSKDKLDQVSSEIKEKFKVETRTIAVDFASEDIYDKIKT
GLAGLEIGILVNNVGMSYEYPEYFLDVPDLDNVIKKMININILSVCKMTQLVLPGMVERS
KGAILNISSGSGMLPVPLLTIYSATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKLA
KIRKPTLDKPSPETFVKSAIKTVGLQSRTNGYLIHALMGSIISNLPSWIYLKIVMNMNKS
TRAHYLKKTKKN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q53GQ0	1.000	1.000	4.608E-63	312	1.000	1.000	Q53GQ0.pdb.gz	DHB12_HUMAN Very-long-chain 3-oxoacyl-CoA reductase OS=Homo sapiens OX=9606 GN=HSD17B12 PE=1 SV=2
2	AFDB:O70503	0.987	0.987	2.005E-54	312	0.811	0.811	O70503.pdb.gz	DHB12_MOUSE Very-long-chain 3-oxoacyl-CoA reductase OS=Mus musculus OX=10090 GN=Hsd17b12 PE=1 SV=1
3	AFDB:Q9W3N1	0.920	0.895	3.487E-36	321	0.446	0.433	Q9W3N1.pdb.gz	Q9W3N1_DROME RH59310p OS=Drosophila melanogaster OX=7227 GN=spidey PE=1 SV=1
4	AFDB:Q1JQ48	0.913	0.828	2.372E-35	345	0.449	0.406	Q1JQ48.pdb.gz
5	AFDB:Q6QA32	0.881	0.894	1.572E-33	307	0.349	0.355	Q6QA32.pdb.gz	DHB3_DANRE 17-beta-hydroxysteroid dehydrogenase type 3 OS=Danio rerio OX=7955 GN=hsd17b3 PE=1 SV=1
6	AFDB:P37058	0.867	0.873	4.353E-33	310	0.394	0.397	P37058.pdb.gz	DHB3_HUMAN 17-beta-hydroxysteroid dehydrogenase type 3 OS=Homo sapiens OX=9606 GN=HSD17B3 PE=1 SV=2
7	AFDB:Q3SXM5	0.908	0.860	1.205E-32	330	0.388	0.367	Q3SXM5.pdb.gz	HSDL1_HUMAN Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Homo sapiens OX=9606 GN=HSDL1 PE=1 SV=3
8	AFDB:O54939	0.833	0.849	5.077E-32	306	0.385	0.392	O54939.pdb.gz	DHB3_RAT 17-beta-hydroxysteroid dehydrogenase type 3 OS=Rattus norvegicus OX=10116 GN=Hsd17b3 PE=2 SV=1
9	AFDB:Q09517	0.885	0.875	8.200E-32	316	0.388	0.383	Q09517.pdb.gz	LE767_CAEEL Very-long-chain 3-oxooacyl-coA reductase let-767 OS=Caenorhabditis elegans OX=6239 GN=let-767 PE=1 SV=2
10	AFDB:Q8BTX9	0.891	0.844	8.706E-32	330	0.381	0.361	Q8BTX9.pdb.gz	HSDL1_MOUSE Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Mus musculus OX=10090 GN=Hsdl1 PE=1 SV=1
11	PDB:3rkuA	0.567	0.656	3.344E-16	268	0.186	0.216	3rkuA.pdb.gz	Substrate Fingerprint and the Structure of NADP+ Dependent Serine Dehydrogenase from Saccharomyces cerevisiae complexed with NADP+
12	PDB:5ojgA	0.617	0.732	3.344E-16	260	0.192	0.231	5ojgA.pdb.gz	Crystal structure and catalytic characterization of the dehydrogenase/reductase SDR family member 4 (DHRS4) from Caenorhabditis elegans.
13	PDB:1cydA	0.590	0.748	5.400E-16	242	0.192	0.248	1cydA.pdb.gz	Crystal structure of the ternary complex of mouse lung carbonyl reductase at 1.8 A resolution: the structural origin of coenzyme specificity in the short-chain dehydrogenase/reductase family.
14	PDB:2ewmB	0.616	0.769	5.733E-16	247	0.160	0.202	2ewmB.pdb.gz	Crystal Structure and Enzyme kinetics of the (S)-Specific 1-Phenylethanol Dehydrogenase of the denitrifying bacterium Strain EbN1
15	PDB:2c07A	0.597	0.748	6.463E-16	246	0.205	0.260	2c07A.pdb.gz
16	PDB:4k26A	0.652	0.760	8.214E-16	265	0.183	0.215	4k26A.pdb.gz	1,1-Dioxo-5,6-dihydro-[4,1,2]oxathiazines, a novel class of 11-HSD1 inhibitors for the treatment of diabetes.
17	PDB:1h5qA	0.585	0.692	1.249E-15	260	0.173	0.208	1h5qA.pdb.gz	The Crystallographic Structure of the Mannitol 2-Dehydrogenase Nadp+ Binary Complex from Agaricus Bisporus
18	PDB:3a28C	0.592	0.709	1.790E-15	257	0.196	0.237	3a28C.pdb.gz	Structural basis for chiral substrate recognition by two 2,3-butanediol dehydrogenases
19	PDB:3ndrA	0.599	0.746	1.790E-15	247	0.176	0.223	3ndrA.pdb.gz	Crystallization and preliminary X-ray analysis of SDR-type pyridoxal dehydrogenase from Mesorhizobium loti
20	PDB:1nffA	0.594	0.748	2.018E-15	244	0.160	0.205	1nffA.pdb.gz	Directed evolution approach to a structural genomics project: Rv2002 from Mycobacterium tuberculosis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O70503	0.0	529	312	0.811	0.811	DHB12_MOUSE Very-long-chain 3-oxoacyl-CoA reductase OS=Mus musculus OX=10090 GN=Hsd17b12 PE=1 SV=1
2	Q53GQ0	0.0	637	312	1.000	1.000	DHB12_HUMAN Very-long-chain 3-oxoacyl-CoA reductase OS=Homo sapiens OX=9606 GN=HSD17B12 PE=1 SV=2
3	Q9W3N1	1.80e-85	261	321	0.433	0.421	Q9W3N1_DROME RH59310p OS=Drosophila melanogaster OX=7227 GN=spidey PE=1 SV=1
4	A2BFP6	9.60e-77	239	329	0.433	0.410	A2BFP6_DANRE 20beta-hydroxysteroid dehydrogenase type 2 OS=Danio rerio OX=7955 GN=hsd20b2 PE=2 SV=1
5	Q3SXM5	4.73e-74	232	330	0.385	0.364	HSDL1_HUMAN Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Homo sapiens OX=9606 GN=HSDL1 PE=1 SV=3
6	Q6QA32	2.41e-72	227	307	0.349	0.355	DHB3_DANRE 17-beta-hydroxysteroid dehydrogenase type 3 OS=Danio rerio OX=7955 GN=hsd17b3 PE=1 SV=1
7	Q8BTX9	4.59e-72	227	330	0.356	0.336	HSDL1_MOUSE Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Mus musculus OX=10090 GN=Hsdl1 PE=1 SV=1
8	P37058	2.71e-69	219	310	0.381	0.384	DHB3_HUMAN 17-beta-hydroxysteroid dehydrogenase type 3 OS=Homo sapiens OX=9606 GN=HSD17B3 PE=1 SV=2
9	Q8L9C4	4.06e-67	214	318	0.340	0.333	KCR1_ARATH Very-long-chain 3-oxoacyl-CoA reductase 1 OS=Arabidopsis thaliana OX=3702 GN=KCR1 PE=1 SV=1
10	Q86BQ3	1.72e-66	213	325	0.365	0.351	Q86BQ3_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG13284 PE=3 SV=1
11	D5SHN1	3.77e-66	212	338	0.365	0.337	D5SHN1_DROME MIP22165p OS=Drosophila melanogaster OX=7227 GN=CG13284-RB PE=2 SV=1
12	Q8IGQ3	4.00e-66	212	339	0.365	0.336	Q8IGQ3_DROME RE48687p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG13284 PE=2 SV=1
13	Q09517	4.07e-66	211	316	0.404	0.399	LE767_CAEEL Very-long-chain 3-oxooacyl-coA reductase let-767 OS=Caenorhabditis elegans OX=6239 GN=let-767 PE=1 SV=2
14	O54939	5.61e-65	208	306	0.356	0.363	DHB3_RAT 17-beta-hydroxysteroid dehydrogenase type 3 OS=Rattus norvegicus OX=10116 GN=Hsd17b3 PE=2 SV=1
15	Q9FYL6	2.01e-58	192	312	0.311	0.311	KCR2_ARATH Very-long-chain 3-oxoacyl-CoA reductase-like protein At1g24470 OS=Arabidopsis thaliana OX=3702 GN=KCR2 PE=2 SV=1
16	A5WWC6	4.34e-52	176	319	0.298	0.292	HSDL1_DANRE Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Danio rerio OX=7955 GN=hsdl1 PE=2 SV=1
17	Q10245	3.76e-49	169	341	0.337	0.308	MKAR_SCHPO Very-long-chain 3-oxoacyl-CoA reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4G9.15 PE=3 SV=1
18	P38286	2.13e-45	159	347	0.340	0.305	MKAR_YEAST Very-long-chain 3-oxoacyl-CoA reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IFA38 PE=1 SV=1
19	Q57VE2	1.95e-41	147	311	0.295	0.296	Q57VE2_TRYB2 Short-chain dehydrogenase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.30H13.140 PE=4 SV=1
20	Q6FRM0	3.98e-39	142	352	0.340	0.301	MKAR_CANGA Very-long-chain 3-oxoacyl-CoA reductase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0H07513g PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02737 3HCDH_N	70	14.8	3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
2	PF00106 adh_short	6.9e-41	151.4	short chain dehydrogenase
3	PF13561 adh_short_C2	1.3e-18	79.0	Enoyl-(Acyl carrier protein) reductase
4	PF02558 ApbA	3.7e+02	12.2	Ketopantoate reductase PanE/ApbA
5	PF01370 Epimerase	2.3e+02	12.7	NAD dependent epimerase/dehydratase family
6	PF08659 KR	0.0018	29.7	KR domain
7	PF13460 NAD_binding_10	3.9e+02	12.3	NAD(P)H-binding
8	PF02719 Polysacc_synt_2	47	14.6	Polysaccharide biosynthesis protein
9	PF03435 Sacchrp_dh_NADP	8.3	18.1	Saccharopine dehydrogenase NADP binding domain
10	PF02254 TrkA_N	93	14.7	TrkA-N domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000278353

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215567	0.985	Very-long-chain enoyl-CoA reductase
2	9606.ENSP00000355308	0.974	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 1
3	9606.ENSP00000373153	0.974	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2
4	9606.ENSP00000477602	0.974	Elongation of very long chain fatty acids protein 1
5	9606.ENSP00000358831	0.962	Elongation of very long chain fatty acids protein 4
6	9606.ENSP00000254521	0.961	3-keto-steroid reductase
7	9606.ENSP00000359380	0.961	Acyl-CoA desaturase
8	9606.ENSP00000419503	0.960	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4
9	9606.ENSP00000261875	0.959	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3
10	9606.ENSP00000378105	0.959	Elongation of very long chain fatty acids protein 6
11	9606.ENSP00000346693	0.955	Elongation of very long chain fatty acids protein 2
12	9606.ENSP00000424123	0.946	Elongation of very long chain fatty acids protein 7
13	9606.ENSP00000359022	0.936	Elongation of very long chain fatty acids protein 3
14	9606.ENSP00000379683	0.935	Aromatase
15	9606.ENSP00000226444	0.917	Estrogen sulfotransferase
16	9606.ENSP00000363794	0.915	Estradiol 17-beta-dehydrogenase 8
17	9606.ENSP00000466799	0.907	Estradiol 17-beta-dehydrogenase 1
18	9606.ENSP00000478561	0.906	Cytochrome P450 1B1
19	9606.ENSP00000222982	0.905	Cytochrome P450 3A5
20	9606.ENSP00000369050	0.904	Cytochrome P450 1A1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016616	1.000	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0005515	0.996	protein binding
GO:0016620	0.991	oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0003857	0.985	3-hydroxyacyl-CoA dehydrogenase activity
GO:0033764	0.558	steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0071704	0.988	organic substance metabolic process
GO:0044238	0.985	primary metabolic process
GO:0044237	0.978	cellular metabolic process
GO:0006629	0.959	lipid metabolic process
GO:0044281	0.830	small molecule metabolic process
GO:1901360	0.700	organic cyclic compound metabolic process
GO:1901576	0.645	organic substance biosynthetic process
GO:0065007	0.545	biological regulation
GO:0006807	0.528	nitrogen compound metabolic process
GO:0008610	0.495	lipid biosynthetic process
GO:0044249	0.442	cellular biosynthetic process
GO:1901564	0.410	organonitrogen compound metabolic process
GO:0044255	0.402	cellular lipid metabolic process
GO:0032787	0.367	monocarboxylic acid metabolic process
GO:0050789	0.360	regulation of biological process
GO:1901362	0.312	organic cyclic compound biosynthetic process
GO:0050794	0.305	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.997	endoplasmic reticulum
GO:0016020	0.995	membrane
GO:0031090	0.956	organelle membrane
GO:0031984	0.956	organelle subcompartment
GO:0005789	0.940	endoplasmic reticulum membrane
GO:0032991	0.759	protein-containing complex
GO:0071944	0.661	cell periphery
GO:1902494	0.366	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.1.1.-	1.000	With NAD(+) or NADP(+) as acceptor.
EC:1.2.1.-	0.991	With NAD(+) or NADP(+) as acceptor.
RHEA:22432	0.985	a (3S)-3-hydroxyacyl-CoA + NAD(+) = a 3-oxoacyl-CoA + H(+) + NADH
EC:1.1.1.35	0.985	3-hydroxyacyl-CoA dehydrogenase.

[back to server]