StarFunc result for job id Q53GS9

User Input

>input (565 residues)
MSGRSKRESRGSTRGKRESESRGSSGRVKRERDREREPEAASSRGSPVRVKREFEPASAR
EAPASVVPFVRVKREREVDEDSEPEREVRAKNGRVDSEDRRSRHCPYLDTINRSVLDFDF
EKLCSISLSHINAYACLVCGKYFQGRGLKSHAYIHSVQFSHHVFLNLHTLKFYCLPDNYE
IIDSSLEDITYVLKPTFTKQQIANLDKQAKLSRAYDGTTYLPGIVGLNNIKANDYANAVL
QALSNVPPLRNYFLEEDNYKNIKRPPGDIMFLLVQRFGELMRKLWNPRNFKAHVSPHEML
QAVVLCSKKTFQITKQGDGVDFLSWFLNALHSALGGTKKKKKTIVTDVFQGSMRIFTKKL
PHPDLPAEEKEQLLHNDEYQETMVESTFMYLTLDLPTAPLYKDEKEQLIIPQVPLFNILA
KFNGITEKEYKTYKENFLKRFQLTKLPPYLIFCIKRFTKNNFFVEKNPTIVNFPITNVDL
REYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQ
MITLSEAYIQIWKRRDNDETNQQGA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q53GS9	1.000	1.000	0.000	565	1.000	1.000	Q53GS9.pdb.gz	UBP39_HUMAN Ubiquitin carboxyl-terminal hydrolase 39 OS=Homo sapiens OX=9606 GN=USP39 PE=1 SV=2
2	AFDB:A1A5Z2	0.841	0.954	1.163E-91	497	0.761	0.865	A1A5Z2.pdb.gz	A1A5Z2_DANRE ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=wu:fb79f05 PE=1 SV=1
3	AFDB:Q9VWP1	0.814	0.928	6.120E-79	494	0.531	0.607	Q9VWP1.pdb.gz	Q9VWP1_DROME ubiquitinyl hydrolase 1 OS=Drosophila melanogaster OX=7227 GN=Usp39 PE=1 SV=2
4	PDB:3jcrV	0.657	0.848	2.059E-63	431	0.759	0.995	3jcrV.pdb.gz
5	PDB:6ah0W	0.659	0.792	1.109E-62	463	0.782	0.955	6ah0W.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
6	AFDB:Q9USR2	0.736	0.825	6.236E-59	502	0.386	0.434	Q9USR2.pdb.gz	UBP10_SCHPO Probable mRNA-splicing protein ubp10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp10 PE=3 SV=1
7	AFDB:P43589	0.635	0.792	4.274E-37	448	0.242	0.306	P43589.pdb.gz	SAD1_YEAST Pre-mRNA-splicing factor SAD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SAD1 PE=1 SV=1
8	PDB:4msxA	0.617	0.868	1.247E-35	395	0.232	0.332	4msxA.pdb.gz	The crystal structure of S. cerevisiae Sad1, a catalytically inactive deubiquitinase that is broadly required for pre-mRNA splicing.
9	AFDB:Q4JL29	0.502	0.542	3.996E-31	520	0.223	0.242	Q4JL29.pdb.gz	Q4JL29_RAT Ubiquitin carboxyl-terminal hydrolase OS=Rattus norvegicus OX=10116 GN=Usp3 PE=2 SV=1
10	AFDB:Q8TEY7	0.480	0.294	8.701E-27	942	0.211	0.126	Q8TEY7.pdb.gz	UBP33_HUMAN Ubiquitin carboxyl-terminal hydrolase 33 OS=Homo sapiens OX=9606 GN=USP33 PE=1 SV=2
11	AFDB:A5PN09	0.496	0.315	9.203E-27	911	0.214	0.133	A5PN09.pdb.gz	UBP20_DANRE Ubiquitin carboxyl-terminal hydrolase 20 OS=Danio rerio OX=7955 GN=usp20 PE=3 SV=1
12	PDB:3mhsA	0.445	0.543	1.714E-25	455	0.156	0.193	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
13	AFDB:Q8MQX4	0.495	0.318	4.946E-25	896	0.156	0.098	Q8MQX4.pdb.gz	Q8MQX4_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp8 PE=2 SV=1
14	PDB:4wa6D	0.421	0.562	1.288E-22	415	0.145	0.198	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
15	AFDB:X2JG37	0.462	0.281	2.653E-22	950	0.195	0.116	X2JG37.pdb.gz	X2JG37_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp2 PE=3 SV=1
16	PDB:4fjcE	0.408	0.523	1.027E-21	434	0.147	0.191	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
17	PDB:5cvnB	0.449	0.763	1.086E-21	321	0.138	0.243	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
18	PDB:3ihpB	0.454	0.381	1.285E-21	681	0.145	0.120	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex
19	PDB:5k16B	0.452	0.752	1.213E-20	328	0.135	0.232	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
20	PDB:7yxxA	0.436	0.149	8.158E-19	1754	0.145	0.047	7yxxA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087X1B2	0.0	1001	487	0.844	0.979	A0A087X1B2_HUMAN ubiquitinyl hydrolase 1 OS=Homo sapiens OX=9606 GN=USP39 PE=1 SV=1
2	A1A5Z2	0.0	882	497	0.738	0.839	A1A5Z2_DANRE ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=wu:fb79f05 PE=1 SV=1
3	Q53GS9	0.0	1179	565	1.000	1.000	UBP39_HUMAN Ubiquitin carboxyl-terminal hydrolase 39 OS=Homo sapiens OX=9606 GN=USP39 PE=1 SV=2
4	Q9VWP1	0.0	630	494	0.526	0.601	Q9VWP1_DROME ubiquitinyl hydrolase 1 OS=Drosophila melanogaster OX=7227 GN=Usp39 PE=1 SV=2
5	Q9USR2	3.33e-138	412	502	0.388	0.436	UBP10_SCHPO Probable mRNA-splicing protein ubp10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp10 PE=3 SV=1
6	P43589	1.74e-53	190	448	0.246	0.310	SAD1_YEAST Pre-mRNA-splicing factor SAD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SAD1 PE=1 SV=1
7	Q4JL29	3.03e-22	102	520	0.219	0.238	Q4JL29_RAT Ubiquitin carboxyl-terminal hydrolase OS=Rattus norvegicus OX=10116 GN=Usp3 PE=2 SV=1
8	Q9Y6I4	2.19e-21	100	520	0.221	0.240	UBP3_HUMAN Ubiquitin carboxyl-terminal hydrolase 3 OS=Homo sapiens OX=9606 GN=USP3 PE=1 SV=2
9	A0A8I6A351	1.86e-20	97.1	506	0.218	0.243	A0A8I6A351_RAT Ubiquitin carboxyl-terminal hydrolase OS=Rattus norvegicus OX=10116 GN=Usp3 PE=1 SV=1
10	Q6JHV3	7.88e-20	95.1	498	0.218	0.247	Q6JHV3_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP3 PE=1 SV=1
11	H0YMI4	2.86e-19	93.2	503	0.218	0.245	H0YMI4_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP3 PE=1 SV=1
12	O75604	6.94e-19	92.4	605	0.152	0.142	UBP2_HUMAN Ubiquitin carboxyl-terminal hydrolase 2 OS=Homo sapiens OX=9606 GN=USP2 PE=1 SV=2
13	D4A4F6	1.07e-18	91.3	476	0.179	0.212	D4A4F6_RAT Ubiquitin carboxyl-terminal hydrolase OS=Rattus norvegicus OX=10116 GN=Usp3 PE=1 SV=4
14	Q9VDD8	1.55e-18	92.0	896	0.166	0.105	Q9VDD8_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp8 PE=1 SV=2
15	Q8MQX4	2.06e-18	91.7	896	0.166	0.105	Q8MQX4_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp8 PE=2 SV=1
16	H1UUC2	3.43e-18	88.6	367	0.152	0.234	H1UUC2_DROME FI18309p1 OS=Drosophila melanogaster OX=7227 GN=Usp8 PE=2 SV=1
17	O88623	5.75e-18	89.7	619	0.154	0.141	UBP2_MOUSE Ubiquitin carboxyl-terminal hydrolase 2 OS=Mus musculus OX=10090 GN=Usp2 PE=1 SV=3
18	Q5U349	6.32e-18	89.7	618	0.150	0.138	UBP2_RAT Ubiquitin carboxyl-terminal hydrolase 2 OS=Rattus norvegicus OX=10116 GN=Usp2 PE=1 SV=1
19	H0YLB7	6.63e-18	88.6	431	0.179	0.234	H0YLB7_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP3 PE=1 SV=1
20	Q6P8X6	9.87e-18	87.8	390	0.156	0.226	UBP50_MOUSE Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Mus musculus OX=10090 GN=Usp50 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00443 UCH	2.8e-36	137.1	Ubiquitin carboxyl-terminal hydrolase
2	PF13423 UCH_1	6.3	17.9	Ubiquitin carboxyl-terminal hydrolase
3	PF02148 zf-UBP	7.5e-08	43.9	Zn-finger in ubiquitin-hydrolases and other protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312981

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000315379	0.996	U4/U6 small nuclear ribonucleoprotein Prp3
2	9606.ENSP00000310723	0.995	Probable ATP-dependent RNA helicase DDX23
3	9606.ENSP00000324122	0.995	U4/U6 small nuclear ribonucleoprotein Prp31
4	9606.ENSP00000400591	0.991	Small nuclear ribonucleoprotein E
5	9606.ENSP00000249299	0.990	U6 snRNA-associated Sm-like protein LSm8
6	9606.ENSP00000310448	0.990	U4/U6.U5 tri-snRNP-associated protein 1
7	9606.ENSP00000364813	0.990	U6 snRNA-associated Sm-like protein LSm2
8	9606.ENSP00000469468	0.990	U6 snRNA-associated Sm-like protein LSm4
9	9606.ENSP00000272348	0.988	Small nuclear ribonucleoprotein G
10	9606.ENSP00000342374	0.987	Small nuclear ribonucleoprotein Sm D2
11	9606.ENSP00000244227	0.986	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein
12	9606.ENSP00000392094	0.986	116 kDa U5 small nuclear ribonucleoprotein component
13	9606.ENSP00000412566	0.986	Small nuclear ribonucleoprotein-associated proteins B and B
14	9606.ENSP00000269601	0.984	Thioredoxin-like protein 4A
15	9606.ENSP00000215829	0.981	Small nuclear ribonucleoprotein Sm D3
16	9606.ENSP00000410758	0.981	U6 snRNA-associated Sm-like protein LSm5
17	9606.ENSP00000422392	0.981	U6 snRNA-associated Sm-like protein LSm6
18	9606.ENSP00000460348	0.981	Pre-mRNA-processing-splicing factor 8
19	9606.ENSP00000252622	0.980	U6 snRNA-associated Sm-like protein LSm7
20	9606.ENSP00000266735	0.980	Small nuclear ribonucleoprotein F

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140096	0.994	catalytic activity, acting on a protein
GO:0016787	0.992	hydrolase activity
GO:0008233	0.978	peptidase activity
GO:0019783	0.970	ubiquitin-like protein peptidase activity
GO:0101005	0.943	deubiquitinase activity
GO:0008234	0.935	cysteine-type peptidase activity
GO:0004843	0.919	cysteine-type deubiquitinase activity
GO:1901363	0.379	heterocyclic compound binding
GO:0097159	0.379	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.981	organic substance metabolic process
GO:0044238	0.979	primary metabolic process
GO:0043170	0.973	macromolecule metabolic process
GO:0044237	0.969	cellular metabolic process
GO:0006807	0.953	nitrogen compound metabolic process
GO:0000398	0.926	mRNA splicing, via spliceosome
GO:0022618	0.887	ribonucleoprotein complex assembly
GO:0000245	0.695	spliceosomal complex assembly
GO:0050789	0.565	regulation of biological process
GO:0019538	0.518	protein metabolic process
GO:0043412	0.517	macromolecule modification
GO:0036211	0.487	protein modification process
GO:0050794	0.472	regulation of cellular process
GO:0019222	0.463	regulation of metabolic process
GO:0060255	0.432	regulation of macromolecule metabolic process
GO:0080090	0.396	regulation of primary metabolic process
GO:0051171	0.393	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.999	protein-containing complex
GO:0030532	0.975	small nuclear ribonucleoprotein complex
GO:0097525	0.952	spliceosomal snRNP complex
GO:0046540	0.885	U4/U6 x U5 tri-snRNP complex
GO:0005681	0.497	spliceosomal complex
GO:0071011	0.488	precatalytic spliceosome
GO:0071005	0.401	U2-type precatalytic spliceosome
GO:0005737	0.347	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.992	Hydrolases.
EC:3.4.-.-	0.978	Acting on peptide bonds (peptidases).
EC:3.4.19.12	0.919	ubiquitinyl hydrolase 1.

[back to server]