StarFunc result for job id Q53GT1

User Input

>input (634 residues)
MAEEQEFTQLCKLPAQPSHPHCVNNTYRSAQHSQALLRGLLALRDSGILFDVVLVVEGRH
IEAHRILLAASCDYFRGMFAGGLKEMEQEEVLIHGVSYNAMCQILHFIYTSELELSLSNV
QETLVAACQLQIPEIIHFCCDFLMSWVDEENILDVYRLAELFDLSRLTEQLDTYILKNFV
AFSRTDKYRQLPLEKVYSLLSSNRLEVSCETEVYEGALLYHYSLEQVQADQISLHEPPKL
LETVRFPLMEAEVLQRLHDKLDPSPLRDTVASALMYHRNESLQPSLQSPQTELRSDFQCV
VGFGGIHSTPSTVLSDQAKYLNPLLGEWKHFTASLAPRMSNQGIAVLNNFVYLIGGDNNV
QGFRAESRCWRYDPRHNRWFQIQSLQQEHADLSVCVVGRYIYAVAGRDYHNDLNAVERYD
PATNSWAYVAPLKREVYAHAGATLEGKMYITCGRRGEDYLKETHCYDPGSNTWHTLADGP
VRRAWHGMATLLNKLYVIGGSNNDAGYRRDVHQVACYSCTSGQWSSVCPLPAGHGEPGIA
VLDNRIYVLGGRSHNRGSRTGYVHIYDVEKDCWEEGPQLDNSISGLAACVLTLPRSLLLE
PPRGTPDRSQADPDFASEVMSVSDWEEFDNSSED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q53GT1	1.000	1.000	0.000	634	1.000	1.000	Q53GT1.pdb.gz	KLH22_HUMAN Kelch-like protein 22 OS=Homo sapiens OX=9606 GN=KLHL22 PE=1 SV=2
2	AFDB:Q8N4N3	0.781	0.802	5.525E-62	616	0.320	0.330	Q8N4N3.pdb.gz	KLH36_HUMAN Kelch-like protein 36 OS=Homo sapiens OX=9606 GN=KLHL36 PE=1 SV=1
3	AFDB:Q53HC5	0.729	0.749	1.372E-60	615	0.308	0.317	Q53HC5.pdb.gz	KLH26_HUMAN Kelch-like protein 26 OS=Homo sapiens OX=9606 GN=KLHL26 PE=1 SV=2
4	AFDB:Q9P2N7	0.730	0.709	1.252E-59	655	0.323	0.313	Q9P2N7.pdb.gz	KLH13_HUMAN Kelch-like protein 13 OS=Homo sapiens OX=9606 GN=KLHL13 PE=1 SV=3
5	AFDB:Q8BWA5	0.745	0.745	1.059E-56	634	0.249	0.249	Q8BWA5.pdb.gz	KLH31_MOUSE Kelch-like protein 31 OS=Mus musculus OX=10090 GN=Klhl31 PE=1 SV=1
6	AFDB:Q96M94	0.766	0.801	1.552E-55	604	0.276	0.290	Q96M94.pdb.gz	KLH15_HUMAN Kelch-like protein 15 OS=Homo sapiens OX=9606 GN=KLHL15 PE=1 SV=2
7	AFDB:Q96NJ5	0.779	0.795	2.159E-54	620	0.278	0.284	Q96NJ5.pdb.gz	KLH32_HUMAN Kelch-like protein 32 OS=Homo sapiens OX=9606 GN=KLHL32 PE=1 SV=2
8	AFDB:Q6TDP4	0.580	0.575	1.245E-52	642	0.273	0.269	Q6TDP4.pdb.gz	KLH17_HUMAN Kelch-like protein 17 OS=Homo sapiens OX=9606 GN=KLHL17 PE=1 SV=1
9	AFDB:Q69ZK5	0.615	0.619	1.707E-52	630	0.256	0.257	Q69ZK5.pdb.gz	KLH14_MOUSE Kelch-like protein 14 OS=Mus musculus OX=10090 GN=Klhl14 PE=1 SV=2
10	AFDB:A5PKX1	0.469	0.418	9.207E-52	718	0.244	0.216	A5PKX1.pdb.gz	A5PKX1_HUMAN Kelch-like 4 (Drosophila) OS=Homo sapiens OX=9606 GN=KLHL4 PE=2 SV=1
11	PDB:5gq0A	0.353	0.641	2.888E-16	338	0.084	0.157	5gq0A.pdb.gz
12	PDB:5gqtA	0.349	0.465	3.961E-16	470	0.085	0.115	5gqtA.pdb.gz
13	PDB:2uvkB	0.347	0.614	1.093E-14	349	0.077	0.140	2uvkB.pdb.gz
14	PDB:2zwaB	0.343	0.320	3.396E-12	683	0.062	0.057	2zwaB.pdb.gz	Structural basis of tRNA modification with CO2 fixation and methylation by wybutosine synthesizing enzyme TYW4.
15	PDB:7d4iBE	0.275	0.205	2.763E-8	890	0.060	0.043	7d4iBE.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
16	PDB:2hqsA	0.340	0.495	2.912E-8	412	0.043	0.066	2hqsA.pdb.gz
17	PDB:5c2vB	0.290	0.479	3.994E-8	352	0.055	0.099	5c2vB.pdb.gz	The inner workings of the hydrazine synthase multiprotein complex.
18	PDB:7z8bF	0.238	0.308	5.478E-8	457	0.082	0.114	7z8bF.pdb.gz	Structure of CRL7 FBXW8 reveals coupling with CUL1-RBX1/ROC1 for multi-cullin-RING E3-catalyzed ubiquitin ligation.
19	PDB:1n6dA	0.208	0.135	7.127E-8	1023	0.058	0.036	1n6dA.pdb.gz	Navigation Inside a Protease: Substrate Selection and Product Exit in the Tricorn Protease from Thermoplasma acidophilum
20	PDB:5jozA	0.270	0.327	9.775E-8	507	0.071	0.089	5jozA.pdb.gz	Structural dissection of a complex Bacteroides ovatus gene locus conferring xyloglucan metabolism in the human gut.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q53GT1	0.0	1320	634	1.000	1.000	KLH22_HUMAN Kelch-like protein 22 OS=Homo sapiens OX=9606 GN=KLHL22 PE=1 SV=2
2	Q99JN2	0.0	1237	634	0.946	0.946	KLH22_MOUSE Kelch-like protein 22 OS=Mus musculus OX=10090 GN=Klhl22 PE=1 SV=1
3	Q9P2N7	2.37e-110	348	655	0.323	0.313	KLH13_HUMAN Kelch-like protein 13 OS=Homo sapiens OX=9606 GN=KLHL13 PE=1 SV=3
4	Q9P2J3	1.54e-109	344	617	0.328	0.337	KLHL9_HUMAN Kelch-like protein 9 OS=Homo sapiens OX=9606 GN=KLHL9 PE=1 SV=2
5	Q53HC5	1.63e-103	328	615	0.311	0.320	KLH26_HUMAN Kelch-like protein 26 OS=Homo sapiens OX=9606 GN=KLHL26 PE=1 SV=2
6	Q8N4N3	3.63e-97	312	616	0.315	0.325	KLH36_HUMAN Kelch-like protein 36 OS=Homo sapiens OX=9606 GN=KLHL36 PE=1 SV=1
7	Q96M94	9.48e-83	274	604	0.293	0.308	KLH15_HUMAN Kelch-like protein 15 OS=Homo sapiens OX=9606 GN=KLHL15 PE=1 SV=2
8	Q9H511	2.50e-81	271	634	0.263	0.263	KLH31_HUMAN Kelch-like protein 31 OS=Homo sapiens OX=9606 GN=KLHL31 PE=2 SV=1
9	Q8BWA5	3.34e-79	265	634	0.260	0.260	KLH31_MOUSE Kelch-like protein 31 OS=Mus musculus OX=10090 GN=Klhl31 PE=1 SV=1
10	Q9Y2M5	1.44e-73	249	609	0.273	0.284	KLH20_HUMAN Kelch-like protein 20 OS=Homo sapiens OX=9606 GN=KLHL20 PE=1 SV=4
11	Q96NJ5	3.29e-69	238	620	0.284	0.290	KLH32_HUMAN Kelch-like protein 32 OS=Homo sapiens OX=9606 GN=KLHL32 PE=1 SV=2
12	Q96PQ7	7.29e-67	234	755	0.251	0.211	KLHL5_HUMAN Kelch-like protein 5 OS=Homo sapiens OX=9606 GN=KLHL5 PE=1 SV=3
13	E9Q4F2	1.94e-65	227	574	0.252	0.279	KLH18_MOUSE Kelch-like protein 18 OS=Mus musculus OX=10090 GN=Klhl18 PE=1 SV=1
14	O94889	3.86e-65	226	574	0.251	0.277	KLH18_HUMAN Kelch-like protein 18 OS=Homo sapiens OX=9606 GN=KLHL18 PE=1 SV=3
15	Q8K430	7.42e-65	227	640	0.279	0.277	KLH17_RAT Kelch-like protein 17 OS=Rattus norvegicus OX=10116 GN=Klhl17 PE=1 SV=1
16	Q6TDP4	1.18e-64	226	642	0.281	0.277	KLH17_HUMAN Kelch-like protein 17 OS=Homo sapiens OX=9606 GN=KLHL17 PE=1 SV=1
17	Q5U374	1.27e-62	219	564	0.257	0.289	KLH12_DANRE Kelch-like protein 12 OS=Danio rerio OX=7955 GN=klhl12 PE=2 SV=2
18	Q9VUU5	1.30e-62	220	623	0.265	0.270	KLHDB_DROME Kelch-like protein diablo OS=Drosophila melanogaster OX=7227 GN=dbo PE=1 SV=1
19	Q9NR64	5.09e-62	221	748	0.246	0.209	KLHL1_HUMAN Kelch-like protein 1 OS=Homo sapiens OX=9606 GN=KLHL1 PE=1 SV=1
20	Q9P2G3	1.80e-61	217	628	0.232	0.234	KLH14_HUMAN Kelch-like protein 14 OS=Homo sapiens OX=9606 GN=KLHL14 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07707 BACK	1.9e-12	58.5	BTB And C-terminal Kelch
2	PF00651 BTB	6.9e-24	95.6	BTB/POZ domain
3	PF01344 Kelch_1	5.4e-42	152.5	Kelch motif
4	PF07646 Kelch_2	2.9e-17	73.2	Kelch motif
5	PF13415 Kelch_3	8.1e-20	82.0	Galactose oxidase, central domain
6	PF13418 Kelch_4	4.4e-14	63.5	Galactose oxidase, central domain
7	PF13854 Kelch_5	0.09	23.9	Kelch motif
8	PF13964 Kelch_6	2.4e-35	130.9	Kelch motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000331682

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264414	0.999	Cullin-3
2	9606.ENSP00000443191	0.974	Kelch-like protein 13
3	9606.ENSP00000351933	0.944	Kelch-like protein 9
4	9606.ENSP00000215739	0.935	Leucine-zipper-like transcriptional regulator 1
5	9606.ENSP00000377001	0.932	Speckle-type POZ protein
6	9606.ENSP00000366886	0.923	Kelch-like protein 21
7	9606.ENSP00000209884	0.919	Kelch-like protein 20
8	9606.ENSP00000216225	0.918	E3 ubiquitin-protein ligase RBX1
9	9606.ENSP00000356230	0.917	Kelch-like protein 12
10	9606.ENSP00000280098	0.915	Speckle-type POZ protein-like
11	9606.ENSP00000312397	0.910	Kelch-like protein 3
12	9606.ENSP00000273963	0.908	Kelch-like protein 8
13	9606.ENSP00000479101	0.908	Ectoderm-neural cortex protein 1
14	9606.ENSP00000370671	0.907	Kelch-like protein 42
15	9606.ENSP00000171111	0.906	Kelch-like ECH-associated protein 1
16	9606.ENSP00000343273	0.904	Kelch-like protein 7
17	9606.ENSP00000385096	0.904	BTB/POZ domain-containing protein KCTD17
18	9606.ENSP00000336800	0.902	Kelch-like protein 25
19	9606.ENSP00000455785	0.901	BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 1
20	9606.ENSP00000476795	0.901	Gigaxonin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0071889	0.891	14-3-3 protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0071704	0.977	organic substance metabolic process
GO:0044238	0.971	primary metabolic process
GO:0006807	0.969	nitrogen compound metabolic process
GO:0043170	0.932	macromolecule metabolic process
GO:0051716	0.925	cellular response to stimulus
GO:1901564	0.920	organonitrogen compound metabolic process
GO:0019538	0.904	protein metabolic process
GO:0048518	0.893	positive regulation of biological process
GO:0048522	0.830	positive regulation of cellular process
GO:0042221	0.804	response to chemical
GO:0036211	0.778	protein modification process
GO:0016567	0.766	protein ubiquitination
GO:0048583	0.745	regulation of response to stimulus
GO:0048519	0.732	negative regulation of biological process
GO:1902531	0.727	regulation of intracellular signal transduction
GO:0070887	0.723	cellular response to chemical stimulus
GO:0048523	0.712	negative regulation of cellular process
GO:0010033	0.699	response to organic substance
GO:0032006	0.606	regulation of TOR signaling
GO:0044237	0.575	cellular metabolic process
GO:0071229	0.570	cellular response to acid chemical
GO:0032008	0.569	positive regulation of TOR signaling
GO:1903432	0.568	regulation of TORC1 signaling
GO:0051603	0.551	proteolysis involved in protein catabolic process
GO:0006511	0.541	ubiquitin-dependent protein catabolic process
GO:0009719	0.537	response to endogenous stimulus
GO:0010243	0.535	response to organonitrogen compound
GO:0071310	0.533	cellular response to organic substance
GO:0010564	0.526	regulation of cell cycle process
GO:1901700	0.507	response to oxygen-containing compound
GO:0019222	0.470	regulation of metabolic process
GO:0010498	0.458	proteasomal protein catabolic process
GO:1904263	0.440	positive regulation of TORC1 signaling
GO:0071230	0.438	cellular response to amino acid stimulus
GO:0060255	0.329	regulation of macromolecule metabolic process
GO:0080090	0.328	regulation of primary metabolic process
GO:0051171	0.327	regulation of nitrogen compound metabolic process
GO:0007165	0.326	signal transduction
GO:0043161	0.321	proteasome-mediated ubiquitin-dependent protein catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0005829	0.998	cytosol
GO:0031463	0.995	Cul3-RING ubiquitin ligase complex
GO:0043232	0.984	intracellular non-membrane-bounded organelle
GO:0043227	0.937	membrane-bounded organelle
GO:0043231	0.934	intracellular membrane-bounded organelle
GO:0005856	0.933	cytoskeleton
GO:0005634	0.707	nucleus
GO:0005819	0.477	spindle
GO:0099080	0.378	supramolecular complex
GO:0043233	0.356	organelle lumen
GO:0070013	0.331	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]