StarFunc result for job id Q53H12

User Input

>input (422 residues)
MTVFFKTLRNHWKKTTAGLCLLTWGGHWLYGKHCDNLLRRAACQEAQVFGNQLIPPNAQV
KKATVFLNPAACKGKARTLFEKNAAPILHLSGMDVTIVKTDYEGQAKKLLELMENTDVII
VAGGDGTLQEVVTGVLRRTDEATFSKIPIGFIPLGETSSLSHTLFAESGNKVQHITDATL
AIVKGETVPLDVLQIKGEKEQPVFAMTGLRWGSFRDAGVKVSKYWYLGPLKIKAAHFFST
LKEWPQTHQASISYTGPTERPPNEPEETPVQRPSLYRRILRRLASYWAQPQDALSQEVSP
EVWKDVQLSTIELSITTRNNQLDPTSKEDFLNICIEPDTISKGDFITIGSRKVRNPKLHV
EGTECLQASQCTLLIPEGAGGSFSIDSEEYEAMPVEVKLLPRKLQFFCDPRKREQMLTSP
TQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A4D1U5	0.985	0.985	1.439E-84	422	1.000	1.000	A4D1U5.pdb.gz	A4D1U5_HUMAN Acylglycerol kinase, mitochondrial OS=Homo sapiens OX=9606 GN=FLJ10842 PE=3 SV=1
2	PDB:7cgpB	0.795	0.969	2.802E-58	345	0.815	0.997	7cgpB.pdb.gz
3	AFDB:Q9VL10	0.715	0.739	1.346E-30	408	0.249	0.257	Q9VL10.pdb.gz	Q9VL10_DROME Acylglycerol kinase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Mulk PE=1 SV=2
4	AFDB:Q53ZR5	0.611	0.667	3.192E-25	384	0.168	0.185	Q53ZR5.pdb.gz	Q53ZR5_HUMAN Sphingosine kinase 1 OS=Homo sapiens OX=9606 GN=SPHK1 PE=2 SV=1
5	AFDB:Q8CI15	0.609	0.667	4.240E-25	382	0.180	0.199	Q8CI15.pdb.gz	SPHK1_MOUSE Sphingosine kinase 1 OS=Mus musculus OX=10090 GN=Sphk1 PE=1 SV=1
6	PDB:4l02A	0.609	0.704	1.068E-24	360	0.180	0.211	4l02A.pdb.gz	Structure guided design of a series of sphingosine kinase (SphK) inhibitors.
7	AFDB:Q9VZW0	0.611	0.404	2.078E-24	661	0.175	0.112	Q9VZW0.pdb.gz	Q9VZW0_DROME LD11247p OS=Drosophila melanogaster OX=7227 GN=Sk2 PE=2 SV=3
8	AFDB:Q91V26	0.614	0.671	2.464E-24	383	0.185	0.204	Q91V26.pdb.gz	SPHK1_RAT Sphingosine kinase 1 OS=Rattus norvegicus OX=10116 GN=Sphk1 PE=1 SV=1
9	AFDB:Q86KF9	0.613	0.425	5.154E-24	624	0.175	0.119	Q86KF9.pdb.gz	SPHKA_DICDI Sphingosine kinase A OS=Dictyostelium discoideum OX=44689 GN=sgkA PE=2 SV=2
10	AFDB:A2AQH1	0.615	0.503	7.246E-24	525	0.171	0.137	A2AQH1.pdb.gz	A2AQH1_MOUSE Ceramide kinase-like OS=Mus musculus OX=10090 GN=Cerkl PE=2 SV=1
11	AFDB:Q8TCT0	0.593	0.475	7.669E-24	537	0.171	0.134	Q8TCT0.pdb.gz	CERK1_HUMAN Ceramide kinase OS=Homo sapiens OX=9606 GN=CERK PE=1 SV=1
12	AFDB:Q9VYY8	0.609	0.415	1.353E-23	641	0.182	0.120	Q9VYY8.pdb.gz	Q9VYY8_DROME RE64552p OS=Drosophila melanogaster OX=7227 GN=Sk1 PE=1 SV=1
13	PDB:2qv7A	0.503	0.680	2.301E-16	303	0.159	0.221	2qv7A.pdb.gz	Analysis of the Staphylococcus aureus DgkB Structure Reveals a Common Catalytic Mechanism for the Soluble Diacylglycerol Kinases.
14	PDB:2bonB	0.459	0.693	7.531E-14	265	0.128	0.204	2bonB.pdb.gz	Crystal Structure of Yegs, a Homologue to the Mammalian Diacylglycerol Kinases, Reveals a Novel Regulatory Metal Binding Site.
15	PDB:2bonA	0.492	0.688	1.329E-13	287	0.133	0.195	2bonA.pdb.gz	Crystal Structure of Yegs, a Homologue to the Mammalian Diacylglycerol Kinases, Reveals a Novel Regulatory Metal Binding Site.
16	PDB:7mezB	0.417	0.337	1.270E-8	547	0.147	0.113	7mezB.pdb.gz
17	PDB:1suwA	0.401	0.620	6.974E-8	249	0.095	0.161	1suwA.pdb.gz	Crystal Structures of an NAD Kinase from Archaeoglobus fulgidus in Complex with ATP, NAD, or NADP
18	PDB:1u0rD	0.368	0.482	1.378E-7	301	0.090	0.126	1u0rD.pdb.gz
19	PDB:3afoA	0.408	0.463	1.005E-6	360	0.083	0.097	3afoA.pdb.gz	The structural factor conferring NADH kinase activity on yeast mitochondrial Pos5
20	PDB:2i2aA	0.344	0.502	1.262E-6	264	0.090	0.144	2i2aA.pdb.gz	NAD kinases use substrate-assisted catalysis for specific recognition of NAD.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A3B3ISY9	0.0	679	330	0.782	1.000	A0A3B3ISY9_HUMAN Acylglycerol kinase, mitochondrial OS=Homo sapiens OX=9606 GN=AGK PE=1 SV=1
2	A0A3B3ISZ0	0.0	725	350	0.827	0.997	A0A3B3ISZ0_HUMAN Acylglycerol kinase, mitochondrial OS=Homo sapiens OX=9606 GN=AGK PE=1 SV=1
3	A0A3B3ITD0	0.0	769	418	0.891	0.900	A0A3B3ITD0_HUMAN Acylglycerol kinase, mitochondrial OS=Homo sapiens OX=9606 GN=AGK PE=1 SV=1
4	A4D1U5	0.0	877	422	1.000	1.000	A4D1U5_HUMAN Acylglycerol kinase, mitochondrial OS=Homo sapiens OX=9606 GN=FLJ10842 PE=3 SV=1
5	E9PC15	0.0	799	394	0.919	0.985	E9PC15_HUMAN Acylglycerol kinase, mitochondrial OS=Homo sapiens OX=9606 GN=AGK PE=1 SV=1
6	Q53H12	0.0	877	422	1.000	1.000	AGK_HUMAN Acylglycerol kinase, mitochondrial OS=Homo sapiens OX=9606 GN=AGK PE=1 SV=2
7	Q9ESW4	0.0	773	421	0.896	0.898	AGK_MOUSE Acylglycerol kinase, mitochondrial OS=Mus musculus OX=10090 GN=Agk PE=1 SV=1
8	Q9VL10	4.28e-30	122	408	0.277	0.287	Q9VL10_DROME Acylglycerol kinase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Mulk PE=1 SV=2
9	Q8L7L1	1.89e-19	92.4	485	0.133	0.115	SPHK1_ARATH Sphingosine kinase 1 OS=Arabidopsis thaliana OX=3702 GN=SPHK1 PE=1 SV=1
10	F2Y4A3	2.12e-18	89.4	481	0.147	0.129	SPHK2_ARATH Sphingosine kinase 2 OS=Arabidopsis thaliana OX=3702 GN=SPHK2 PE=1 SV=1
11	Q9VNA6	1.78e-16	84.0	687	0.116	0.071	Q9VNA6_DROME Ceramide kinase, isoform A OS=Drosophila melanogaster OX=7227 GN=Cerk PE=2 SV=2
12	Q9LRB0	2.04e-16	84.0	763	0.140	0.077	LCBK1_ARATH Sphingoid long-chain bases kinase 1 OS=Arabidopsis thaliana OX=3702 GN=LCBK1 PE=1 SV=1
13	Q91V26	9.56e-16	80.5	383	0.111	0.123	SPHK1_RAT Sphingosine kinase 1 OS=Rattus norvegicus OX=10116 GN=Sphk1 PE=1 SV=1
14	Q8CI15	1.00e-15	80.5	382	0.128	0.141	SPHK1_MOUSE Sphingosine kinase 1 OS=Mus musculus OX=10090 GN=Sphk1 PE=1 SV=1
15	Q95S15	1.28e-15	80.9	487	0.123	0.107	Q95S15_DROME HL01538p OS=Drosophila melanogaster OX=7227 GN=Cerk PE=2 SV=1
16	G0XYF4	9.66e-15	78.2	505	0.147	0.123	G0XYF4_MOUSE Ceramide kinase-like isoform 6 OS=Mus musculus OX=10090 GN=Cerkl PE=2 SV=1
17	A2AQH1	2.22e-14	77.0	525	0.140	0.112	A2AQH1_MOUSE Ceramide kinase-like OS=Mus musculus OX=10090 GN=Cerkl PE=2 SV=1
18	Q8TCT0	3.96e-14	76.3	537	0.140	0.110	CERK1_HUMAN Ceramide kinase OS=Homo sapiens OX=9606 GN=CERK PE=1 SV=1
19	Q8K4Q7	7.14e-14	75.5	531	0.133	0.105	CERK1_MOUSE Ceramide kinase OS=Mus musculus OX=10090 GN=Cerk PE=1 SV=2
20	Q9VYY8	7.30e-14	75.9	641	0.118	0.078	Q9VYY8_DROME RE64552p OS=Drosophila melanogaster OX=7227 GN=Sk1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19712 AGK_C	6.5e-108	370.6	Acylglycerol kinase C-terminal
2	PF00781 DAGK_cat	3e-22	90.0	Diacylglycerol kinase catalytic domain
3	PF01513 NAD_kinase	33	16.3	ATP-NAD kinase N-terminal domain
4	PF03575 Peptidase_S51	3.9e+02	12.1	Peptidase family S51
5	PF11711 Tim54	1.2	19.5	Inner membrane protein import complex subunit Tim54

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347581

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000270502	0.997	Mitochondrial import inner membrane translocase subunit Tim29
2	9606.ENSP00000320236	0.997	Mitochondrial import inner membrane translocase subunit Tim22
3	9606.ENSP00000254616	0.989	Mitochondrial import inner membrane translocase subunit Tim10 B
4	9606.ENSP00000371067	0.943	Tyrosine-protein kinase JAK2
5	9606.ENSP00000223114	0.922	2-acylglycerol O-acyltransferase 3
6	9606.ENSP00000265052	0.921	Monoglyceride lipase
7	9606.ENSP00000302177	0.917	Lysophospholipid acyltransferase 2
8	9606.ENSP00000377900	0.914	Lipase F, gastric type
9	9606.ENSP00000198801	0.909	2-acylglycerol O-acyltransferase 2
10	9606.ENSP00000285518	0.909	1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon
11	9606.ENSP00000406674	0.908	2-acylglycerol O-acyltransferase 1
12	9606.ENSP00000310551	0.907	Lysocardiolipin acyltransferase 1
13	9606.ENSP00000380184	0.906	Glycerol-3-phosphate acyltransferase 4
14	9606.ENSP00000381140	0.906	1-acyl-sn-glycerol-3-phosphate acyltransferase gamma
15	9606.ENSP00000482571	0.906	Glycerol-3-phosphate acyltransferase 3
16	9606.ENSP00000314036	0.905	1-acyl-sn-glycerol-3-phosphate acyltransferase delta
17	9606.ENSP00000360761	0.905	1-acyl-sn-glycerol-3-phosphate acyltransferase beta
18	9606.ENSP00000378877	0.905	1-acyl-sn-glycerol-3-phosphate acyltransferase alpha
19	9606.ENSP00000265276	0.904	Glycerol-3-phosphate acyltransferase 1, mitochondrial
20	9606.ENSP00000251849	0.903	RAF proto-oncogene serine/threonine-protein kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004143	1.000	diacylglycerol kinase activity
GO:0005515	0.998	protein binding
GO:0047620	0.441	acylglycerol kinase activity
GO:0001727	0.399	lipid kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0016043	0.963	cellular component organization
GO:0044238	0.948	primary metabolic process
GO:0071704	0.947	organic substance metabolic process
GO:0006810	0.946	transport
GO:0006996	0.918	organelle organization
GO:0070585	0.912	protein localization to mitochondrion
GO:0007005	0.906	mitochondrion organization
GO:0044237	0.900	cellular metabolic process
GO:0046907	0.863	intracellular transport
GO:0045184	0.857	establishment of protein localization
GO:0006839	0.836	mitochondrial transport
GO:0006807	0.832	nitrogen compound metabolic process
GO:0072655	0.828	establishment of protein localization to mitochondrion
GO:0007006	0.817	mitochondrial membrane organization
GO:0006605	0.813	protein targeting
GO:0051205	0.801	protein insertion into membrane
GO:0007007	0.783	inner mitochondrial membrane organization
GO:1901564	0.766	organonitrogen compound metabolic process
GO:0006626	0.766	protein targeting to mitochondrion
GO:0051204	0.752	protein insertion into mitochondrial membrane
GO:0006629	0.738	lipid metabolic process
GO:0044255	0.716	cellular lipid metabolic process
GO:0006796	0.459	phosphate-containing compound metabolic process
GO:0006643	0.341	membrane lipid metabolic process
GO:0065007	0.317	biological regulation
GO:0009058	0.314	biosynthetic process
GO:0050789	0.307	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.969	membrane
GO:0031090	0.856	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10272	1.000	a 1,2-diacyl-sn-glycerol + ATP = a 1,2-diacyl-sn-glycero-3-phosphate + ADP + H(+)
EC:2.7.1.107	1.000	diacylglycerol kinase (ATP).
RHEA:19293	0.441	a monoacylglycerol + ATP = ADP + H(+) + monoacyl-sn-glycero-3-phosphate
EC:2.7.1.94	0.441	acylglycerol kinase.

[back to server]