StarFunc result for job id Q53H47

User Input

>input (684 residues)
MFAEAAKTTRPCGMAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVG
PGADIDPTQITFPGCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNV
LCRCSDHCRNRVVQKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQR
RIHLQTKSDSNYIIAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSM
VPKLALFAAKDIVPEEELSYDYSGRYLNLTVSEDKERLDHGKLRKPCYCGAKSCTAFLPF
DSSLYCPVEKSNISCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQIRAIFLFEFK
MGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAI
IEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVPHELTENQKNRRFEVSSSLI
LRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAA
GLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQ
KLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDF
YATGINQLISRWQKCVDCNGSYFD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q53H47	1.000	1.000	0.000	684	1.000	1.000	Q53H47.pdb.gz	SETMR_HUMAN Histone-lysine N-methyltransferase SETMAR OS=Homo sapiens OX=9606 GN=SETMAR PE=1 SV=2
2	AFDB:O64827	0.337	0.172	1.270E-20	1382	0.137	0.068	O64827.pdb.gz	SUVR5_ARATH Histone-lysine N-methyltransferase SUVR5 OS=Arabidopsis thaliana OX=3702 GN=SUVR5 PE=1 SV=3
3	AFDB:Q9C5P4	0.315	0.321	4.167E-19	669	0.127	0.130	Q9C5P4.pdb.gz	SUVH3_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH3 OS=Arabidopsis thaliana OX=3702 GN=SUVH3 PE=2 SV=2
4	AFDB:O60016	0.333	0.456	7.317E-19	490	0.135	0.188	O60016.pdb.gz	CLR4_SCHPO Histone-lysine N-methyltransferase, H3 lysine-9 specific OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=clr4 PE=1 SV=2
5	AFDB:A2ABF8	0.311	0.179	1.703E-18	1233	0.124	0.069	A2ABF8.pdb.gz	A2ABF8_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
6	AFDB:O82175	0.311	0.271	2.671E-18	794	0.127	0.110	O82175.pdb.gz	SUVH5_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 OS=Arabidopsis thaliana OX=3702 GN=SUVH5 PE=1 SV=1
7	AFDB:Q8VZ17	0.315	0.274	7.787E-18	790	0.130	0.113	Q8VZ17.pdb.gz	SUVH6_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6 OS=Arabidopsis thaliana OX=3702 GN=SUVH6 PE=1 SV=2
8	AFDB:A0A0G2K889	0.322	0.175	8.238E-18	1289	0.130	0.069	A0A0G2K889.pdb.gz	A0A0G2K889_RAT Euchromatic histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ehmt1 PE=1 SV=2
9	AFDB:A2ABF9	0.310	0.173	1.713E-17	1267	0.118	0.064	A2ABF9.pdb.gz	A2ABF9_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
10	AFDB:Q8GZB6	0.318	0.347	1.713E-17	624	0.132	0.144	Q8GZB6.pdb.gz	SUVH4_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH4 OS=Arabidopsis thaliana OX=3702 GN=SUVH4 PE=1 SV=2
11	PDB:1pegA	0.283	0.683	2.070E-15	266	0.111	0.286	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases
12	PDB:5wg6A	0.197	0.256	1.916E-9	517	0.085	0.112	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
13	PDB:5hynA	0.195	0.228	4.989E-9	581	0.076	0.090	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
14	PDB:7td5F	0.191	0.287	3.023E-8	447	0.088	0.134	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
15	PDB:7ksoA	0.190	0.313	3.199E-8	395	0.092	0.159	7ksoA.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
16	PDB:7td5A	0.191	0.259	4.744E-8	497	0.089	0.123	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
17	PDB:6wkrC	0.214	0.239	8.379E-7	606	0.085	0.096	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
18	PDB:7pikC	0.143	0.169	1.407E-4	557	0.064	0.079	7pikC.pdb.gz	Structural basis of transposon end recognition explains central features of Tn7 transposition systems.
19	PDB:5h6zA	0.136	0.649	8.060E-4	123	0.031	0.171	5h6zA.pdb.gz
20	PDB:1kcfA	0.142	0.286	5.467E-3	240	0.045	0.129	1kcfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q53H47	0.0	1436	684	1.000	1.000	SETMR_HUMAN Histone-lysine N-methyltransferase SETMAR OS=Homo sapiens OX=9606 GN=SETMAR PE=1 SV=2
2	O64827	9.51e-37	150	1382	0.156	0.077	SUVR5_ARATH Histone-lysine N-methyltransferase SUVR5 OS=Arabidopsis thaliana OX=3702 GN=SUVR5 PE=1 SV=3
3	B0S6M0	2.93e-36	143	421	0.129	0.209	B0S6M0_DANRE Histone-lysine N-methyltransferase OS=Danio rerio OX=7955 GN=fe47h06 PE=1 SV=1
4	O43463	1.34e-35	141	412	0.130	0.216	SUV91_HUMAN Histone-lysine N-methyltransferase SUV39H1 OS=Homo sapiens OX=9606 GN=SUV39H1 PE=1 SV=1
5	B1H256	5.83e-35	139	412	0.129	0.214	B1H256_RAT Histone-lysine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Suv39h1 PE=3 SV=1
6	O54864	5.83e-35	139	412	0.129	0.214	SUV91_MOUSE Histone-lysine N-methyltransferase SUV39H1 OS=Mus musculus OX=10090 GN=Suv39h1 PE=1 SV=1
7	A0A8I6AJD7	6.84e-35	139	414	0.129	0.213	A0A8I6AJD7_RAT Histone-lysine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Suv39h1 PE=3 SV=1
8	A0A8I6A0U8	1.55e-34	139	438	0.129	0.201	A0A8I6A0U8_RAT Histone-lysine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Suv39h1 PE=3 SV=1
9	Q6DGD3	3.06e-34	137	411	0.127	0.212	SV91A_DANRE Histone-lysine N-methyltransferase SUV39H1-A OS=Danio rerio OX=7955 GN=suv39h1a PE=2 SV=2
10	Q5DW34	1.18e-33	140	1296	0.140	0.074	EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus OX=10090 GN=Ehmt1 PE=1 SV=2
11	A0A8I6ABS0	1.71e-33	140	1243	0.140	0.077	A0A8I6ABS0_RAT Euchromatic histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ehmt1 PE=1 SV=1
12	D4A005	1.78e-33	140	1285	0.140	0.075	D4A005_RAT Euchromatic histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ehmt1 PE=1 SV=4
13	A0A8I6AB09	1.83e-33	140	1302	0.140	0.074	A0A8I6AB09_RAT Euchromatic histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ehmt1 PE=1 SV=1
14	A0A8I6ANQ0	1.99e-33	140	1276	0.140	0.075	A0A8I6ANQ0_RAT Euchromatic histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ehmt1 PE=1 SV=1
15	A0A0G2K889	2.03e-33	140	1302	0.140	0.074	A0A0G2K889_RAT Euchromatic histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ehmt1 PE=1 SV=2
16	A8TT22	3.87e-33	139	1173	0.126	0.073	A8TT22_DANRE Euchromatic histone lysine N-mthyltransferase EHMT2/G9a OS=Danio rerio OX=7955 GN=g9a PE=1 SV=1
17	A0A1B0GV09	6.32e-33	138	1267	0.140	0.076	A0A1B0GV09_HUMAN Euchromatic histone lysine methyltransferase 1 OS=Homo sapiens OX=9606 GN=EHMT1 PE=1 SV=1
18	Q9H9B1	7.40e-33	138	1298	0.140	0.074	EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens OX=9606 GN=EHMT1 PE=1 SV=4
19	Q9EQQ0	1.19e-32	134	477	0.129	0.184	SUV92_MOUSE Histone-lysine N-methyltransferase SUV39H2 OS=Mus musculus OX=10090 GN=Suv39h2 PE=1 SV=1
20	A0A024RCN9	1.42e-32	137	1210	0.127	0.072	A0A024RCN9_HUMAN EHMT2 OS=Homo sapiens OX=9606 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13358 DDE_3	3.1	19.1	DDE superfamily endonuclease
2	PF14913 DPCD	2.4e+02	12.5	DPCD protein family
3	PF01325 Fe_dep_repress	3.5e+02	12.8	Iron dependent repressor, N-terminal DNA binding domain
4	PF08279 HTH_11	25	16.2	HTH domain
5	PF13384 HTH_23	8.7	17.6	Homeodomain-like domain
6	PF13412 HTH_24	44	15.1	Winged helix-turn-helix DNA-binding
7	PF13551 HTH_29	1.2e+02	14.2	Winged helix-turn helix
8	PF13565 HTH_32	0.032	26.1	Homeodomain-like domain
9	PF13936 HTH_38	35	15.6	Helix-turn-helix domain
10	PF17906 HTH_48	1.5e-11	55.6	HTH domain in Mos1 transposase
11	PF01022 HTH_5	43	15.4	Bacterial regulatory protein, arsR family
12	PF18024 HTH_50	1.4e+02	13.5	Helix-turn-helix domain
13	PF01710 HTH_Tnp_IS630	1.2e+02	14.2	Transposase
14	PF01498 HTH_Tnp_Tc3_2	5.7	18.6	Transposase
15	PF12802 MarR_2	3.2e+02	12.8	MarR family
16	PF09669 Phage_pRha	2.7e+02	13.6	Phage regulatory protein Rha (Phage_pRha)
17	PF05033 Pre-SET	1.4e-08	46.7	Pre-SET motif
18	PF00856 SET	9.6e-15	66.9	SET domain
19	PF01359 Transposase_1	4.2e-24	95.5	Transposase (partial DDE domain)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373354

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000227524	0.988	Pre-mRNA-processing factor 19
2	9606.ENSP00000327436	0.851	Histone-lysine N-methyltransferase setd3
3	9606.ENSP00000385852	0.775	SET domain-containing protein 5
4	9606.ENSP00000421491	0.752	DNA repair protein XRCC4
5	9606.ENSP00000367755	0.742	Calmodulin-lysine N-methyltransferase
6	9606.ENSP00000431404	0.739	PiggyBac transposable element-derived protein 5
7	9606.ENSP00000369666	0.712	F-box/LRR-repeat protein 19
8	9606.ENSP00000301764	0.708	DNA damage-binding protein 1
9	9606.ENSP00000355924	0.699	N-lysine methyltransferase SMYD2
10	9606.ENSP00000432786	0.687	Lysine-specific demethylase 2A
11	9606.ENSP00000272902	0.682	Sulfatase-modifying factor 1
12	9606.ENSP00000366271	0.658	Lysine-specific demethylase 2B
13	9606.ENSP00000454804	0.639	Agouti-signaling protein
14	9606.ENSP00000447879	0.636	Zinc finger BED domain-containing protein 6
15	9606.ENSP00000312379	0.622	Histone-lysine N-methyltransferase 2E
16	9606.ENSP00000419184	0.604	Histone-lysine N-methyltransferase SMYD3
17	9606.ENSP00000462269	0.591	Zinc finger protein 488
18	9606.ENSP00000380692	0.589	Lysine-specific demethylase 7A
19	9606.ENSP00000470142	0.573	Regulator of nonsense transcripts 1
20	9606.ENSP00000305230	0.570	Signal recognition particle 9 kDa protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003690	0.999	double-stranded DNA binding
GO:0000014	0.999	single-stranded DNA endodeoxyribonuclease activity
GO:0019899	0.998	enzyme binding
GO:0046975	0.998	histone H3K36 methyltransferase activity
GO:0042800	0.998	histone H3K4 methyltransferase activity
GO:0042803	0.997	protein homodimerization activity
GO:0003697	0.997	single-stranded DNA binding
GO:0044547	0.819	DNA topoisomerase binding
GO:0043565	0.695	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.988	organic substance metabolic process
GO:0044238	0.987	primary metabolic process
GO:0065007	0.986	biological regulation
GO:0044237	0.985	cellular metabolic process
GO:0050794	0.981	regulation of cellular process
GO:0006259	0.977	DNA metabolic process
GO:0006974	0.974	cellular response to DNA damage stimulus
GO:0048518	0.964	positive regulation of biological process
GO:0006281	0.953	DNA repair
GO:0009893	0.947	positive regulation of metabolic process
GO:0048522	0.946	positive regulation of cellular process
GO:0051052	0.939	regulation of DNA metabolic process
GO:0045005	0.921	DNA-templated DNA replication maintenance of fidelity
GO:0048519	0.918	negative regulation of biological process
GO:0051726	0.915	regulation of cell cycle
GO:0051173	0.914	positive regulation of nitrogen compound metabolic process
GO:0048583	0.906	regulation of response to stimulus
GO:0048523	0.904	negative regulation of cellular process
GO:0031325	0.900	positive regulation of cellular metabolic process
GO:0010604	0.888	positive regulation of macromolecule metabolic process
GO:0045935	0.876	positive regulation of nucleobase-containing compound metabolic process
GO:0080134	0.874	regulation of response to stress
GO:0006302	0.859	double-strand break repair
GO:0010564	0.857	regulation of cell cycle process
GO:2001020	0.856	regulation of response to DNA damage stimulus
GO:0000075	0.842	cell cycle checkpoint signaling
GO:0031297	0.828	replication fork processing
GO:0009056	0.791	catabolic process
GO:0007049	0.783	cell cycle
GO:0006282	0.778	regulation of DNA repair
GO:0033044	0.776	regulation of chromosome organization
GO:0065009	0.757	regulation of molecular function
GO:0022402	0.740	cell cycle process
GO:1901575	0.733	organic substance catabolic process
GO:2000779	0.626	regulation of double-strand break repair
GO:0031570	0.610	DNA integrity checkpoint signaling
GO:0000278	0.597	mitotic cell cycle
GO:0044248	0.591	cellular catabolic process
GO:0046700	0.561	heterocycle catabolic process
GO:0044270	0.558	cellular nitrogen compound catabolic process
GO:0048584	0.497	positive regulation of response to stimulus
GO:1903047	0.478	mitotic cell cycle process
GO:0045930	0.476	negative regulation of mitotic cell cycle
GO:0010468	0.446	regulation of gene expression
GO:0051054	0.404	positive regulation of DNA metabolic process
GO:0009889	0.397	regulation of biosynthetic process
GO:2001022	0.395	positive regulation of response to DNA damage stimulus
GO:0009057	0.392	macromolecule catabolic process
GO:0045739	0.389	positive regulation of DNA repair
GO:0044265	0.379	cellular macromolecule catabolic process
GO:0010556	0.375	regulation of macromolecule biosynthetic process
GO:2000781	0.374	positive regulation of double-strand break repair
GO:0007093	0.372	mitotic cell cycle checkpoint signaling
GO:0044774	0.364	mitotic DNA integrity checkpoint signaling
GO:0044093	0.348	positive regulation of molecular function
GO:0031326	0.342	regulation of cellular biosynthetic process
GO:0032781	0.335	positive regulation of ATP-dependent activity
GO:0034655	0.331	nucleobase-containing compound catabolic process
GO:0006303	0.317	double-strand break repair via nonhomologous end joining
GO:0010639	0.315	negative regulation of organelle organization
GO:0051252	0.311	regulation of RNA metabolic process
GO:1901564	0.302	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	1.000	nuclear lumen
GO:0005694	0.997	chromosome
GO:0005730	0.964	nucleolus
GO:0005654	0.951	nucleoplasm
GO:0090734	0.941	site of DNA damage
GO:0000793	0.873	condensed chromosome
GO:0035861	0.819	site of double-strand break
GO:0005737	0.671	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	1.000	Acting on ester bonds.
RHEA:60260	0.998	L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine
EC:2.1.1.354	0.998	[histone H3]-lysine(4) N-trimethyltransferase.

[back to server]