StarFunc result for job id Q53H76

User Input

>input (456 residues)
MPPGPWESCFWVGGLILWLSVGSSGDAPPTPQPKCADFQSANLFEGTDLKVQFLLFVPSN
PSCGQLVEGSSDLQNSGFNATLGTKLIIHGFRVLGTKPSWIDTFIRTLLRATNANVIAVD
WIYGSTGVYFSAVKNVIKLSLEISLFLNKLLVLGVSESSIHIIGVSLGAHVGGMVGQLFG
GQLGQITGLDPAGPEYTRASVEERLDAGDALFVEAIHTDTDNLGIRIPVGHVDYFVNGGQ
DQPGCPTFFYAGYSYLICDHMRAVHLYISALENSCPLMAFPCASYKAFLAGRCLDCFNPF
LLSCPRIGLVEQGGVKIEPLPKEVKVYLLTTSSAPYCMHHSLVEFHLKELRNKDTNIEVT
FLSSNITSSSKITIPKQQRYGKGIIAHATPQCQINQVKFKFQSSNRVWKKDRTTIIGKFC
TALLPVNDREKMVCLPEPVNLQASVTVSCDLKIACV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q53H76	1.000	1.000	1.339E-101	456	1.000	1.000	Q53H76.pdb.gz	PLA1A_HUMAN Phospholipase A1 member A OS=Homo sapiens OX=9606 GN=PLA1A PE=1 SV=2
2	AFDB:Q8VI78	0.945	0.945	4.230E-88	456	0.811	0.811	Q8VI78.pdb.gz	PLA1A_MOUSE Phospholipase A1 member A OS=Mus musculus OX=10090 GN=Pla1a PE=2 SV=3
3	AFDB:Q8WWY8	0.840	0.849	8.846E-48	451	0.300	0.304	Q8WWY8.pdb.gz	LIPH_HUMAN Lipase member H OS=Homo sapiens OX=9606 GN=LIPH PE=1 SV=1
4	AFDB:Q6XZB0	0.786	0.780	9.179E-46	460	0.296	0.293	Q6XZB0.pdb.gz	LIPI_HUMAN Lipase member I OS=Homo sapiens OX=9606 GN=LIPI PE=1 SV=3
5	AFDB:Q9WVG5	0.773	0.709	1.825E-38	500	0.270	0.246	Q9WVG5.pdb.gz	LIPG_MOUSE Endothelial lipase OS=Mus musculus OX=10090 GN=Lipg PE=2 SV=3
6	AFDB:Q06000	0.728	0.702	1.064E-37	474	0.283	0.272	Q06000.pdb.gz	LIPL_RAT Lipoprotein lipase OS=Rattus norvegicus OX=10116 GN=Lpl PE=1 SV=1
7	AFDB:Q9Y5X9	0.761	0.699	1.064E-37	500	0.270	0.246	Q9Y5X9.pdb.gz	LIPG_HUMAN Endothelial lipase OS=Homo sapiens OX=9606 GN=LIPG PE=1 SV=1
8	AFDB:P11151	0.736	0.704	1.514E-37	478	0.272	0.259	P11151.pdb.gz	LIPL_BOVIN Lipoprotein lipase OS=Bos taurus OX=9913 GN=LPL PE=1 SV=2
9	AFDB:P11150	0.741	0.681	3.064E-37	499	0.289	0.265	P11150.pdb.gz	LIPC_HUMAN Hepatic triacylglycerol lipase OS=Homo sapiens OX=9606 GN=LIPC PE=1 SV=3
10	PDB:6ob0A	0.723	0.744	3.807E-37	442	0.259	0.267	6ob0A.pdb.gz	Structure of lipoprotein lipase in complex with GPIHBP1.
11	PDB:6oauA	0.717	0.770	5.416E-37	422	0.263	0.284	6oauA.pdb.gz	Structure of lipoprotein lipase in complex with GPIHBP1.
12	AFDB:P27656	0.742	0.667	5.513E-37	510	0.272	0.243	P27656.pdb.gz	LIPC_MOUSE Hepatic triacylglycerol lipase OS=Mus musculus OX=10090 GN=Lipc PE=2 SV=2
13	PDB:1bu8A	0.697	0.711	1.084E-35	446	0.254	0.260	1bu8A.pdb.gz
14	PDB:2pvsB	0.688	0.704	1.636E-35	445	0.261	0.267	2pvsB.pdb.gz	Structure of human pancreatic lipase-related protein 2 with the lid in an open conformation.
15	PDB:2pplA	0.680	0.690	7.539E-35	449	0.239	0.243	2pplA.pdb.gz	Two novel human pancreatic lipase related proteins, hPLRP1 and hPLRP2. Differences in colipase dependence and in lipase activity
16	PDB:1lpaB	0.693	0.702	1.193E-33	449	0.261	0.265	1lpaB.pdb.gz	Interfacial activation of the lipase-procolipase complex by mixed micelles revealed by X-ray crystallography.
17	PDB:1rp1A	0.661	0.681	1.761E-31	441	0.246	0.254	1rp1A.pdb.gz	Reactivation of the totally inactive pancreatic lipase RP1 by structure-predicted point mutations.
18	PDB:1q0rA	0.207	0.304	5.065E-4	297	0.061	0.094	1q0rA.pdb.gz	Crystal structure of aclacinomycin methylesterase with bound product analogues: implications for anthracycline recognition and mechanism.
19	PDB:4e15B	0.249	0.352	1.375E-3	303	0.059	0.089	4e15B.pdb.gz
20	PDB:3v99B	0.154	0.116	2.625E-3	639	0.033	0.023	3v99B.pdb.gz	Conversion of human 5-lipoxygenase to a 15-lipoxygenase by a point mutation to mimic phosphorylation at Serine-663.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q53H76	0.0	940	456	1.000	1.000	PLA1A_HUMAN Phospholipase A1 member A OS=Homo sapiens OX=9606 GN=PLA1A PE=1 SV=2
2	Q8VI78	0.0	782	456	0.814	0.814	PLA1A_MOUSE Phospholipase A1 member A OS=Mus musculus OX=10090 GN=Pla1a PE=2 SV=3
3	H0Y3S0	8.63e-82	259	375	0.272	0.331	H0Y3S0_HUMAN Lipase I OS=Homo sapiens OX=9606 GN=LIPI PE=1 SV=2
4	A0A2Q2TCK2	9.64e-80	256	451	0.268	0.271	A0A2Q2TCK2_HUMAN Lipase member I OS=Homo sapiens OX=9606 GN=LIPI PE=1 SV=1
5	Q8WWY8	1.03e-79	256	451	0.296	0.299	LIPH_HUMAN Lipase member H OS=Homo sapiens OX=9606 GN=LIPH PE=1 SV=1
6	Q6XZB0	1.91e-79	255	460	0.268	0.265	LIPI_HUMAN Lipase member I OS=Homo sapiens OX=9606 GN=LIPI PE=1 SV=3
7	A0A087WZG8	8.72e-60	203	421	0.235	0.254	A0A087WZG8_HUMAN Lipase member I OS=Homo sapiens OX=9606 GN=LIPI PE=1 SV=1
8	P11150	7.28e-53	187	499	0.300	0.275	LIPC_HUMAN Hepatic triacylglycerol lipase OS=Homo sapiens OX=9606 GN=LIPC PE=1 SV=3
9	Q8VBX1	1.89e-51	183	493	0.257	0.237	LIPG_RAT Endothelial lipase OS=Rattus norvegicus OX=10116 GN=Lipg PE=2 SV=2
10	Q9WVG5	4.18e-50	179	500	0.257	0.234	LIPG_MOUSE Endothelial lipase OS=Mus musculus OX=10090 GN=Lipg PE=2 SV=3
11	Q9W6Y2	2.09e-48	175	503	0.248	0.225	Q9W6Y2_ONCMY Lipoprotein lipase OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
12	P81139	3.23e-48	173	434	0.239	0.251	LIPR2_CAVPO Pancreatic lipase-related protein 2 OS=Cavia porcellus OX=10141 GN=PNLIPRP2 PE=1 SV=1
13	Q9Y5X9	5.04e-48	174	500	0.276	0.252	LIPG_HUMAN Endothelial lipase OS=Homo sapiens OX=9606 GN=LIPG PE=1 SV=1
14	A0A060Y643	6.20e-48	174	503	0.230	0.209	A0A060Y643_ONCMY Lipoprotein lipase OS=Oncorhynchus mykiss OX=8022 GN=lpl PE=3 SV=1
15	Q6P8U6	8.96e-48	172	465	0.219	0.215	LIPP_MOUSE Pancreatic triacylglycerol lipase OS=Mus musculus OX=10090 GN=Pnlip PE=1 SV=1
16	A0A060VY20	2.68e-47	172	503	0.239	0.217	A0A060VY20_ONCMY Lipoprotein lipase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00075670001 PE=3 SV=1
17	O46559	4.77e-47	171	499	0.292	0.267	LIPC_RABIT Hepatic triacylglycerol lipase OS=Oryctolagus cuniculus OX=9986 GN=LIPC PE=1 SV=1
18	P16233	6.23e-45	164	465	0.219	0.215	LIPP_HUMAN Pancreatic triacylglycerol lipase OS=Homo sapiens OX=9606 GN=PNLIP PE=1 SV=1
19	P54317	2.69e-44	163	469	0.265	0.258	LIPR2_HUMAN Pancreatic lipase-related protein 2 OS=Homo sapiens OX=9606 GN=PNLIPRP2 PE=1 SV=2
20	P54318	3.63e-44	162	468	0.268	0.261	LIPR2_RAT Pancreatic lipase-related protein 2 OS=Rattus norvegicus OX=10116 GN=Pnliprp2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12697 Abhydrolase_6	46	16.1	Alpha/beta hydrolase family
2	PF09558 DUF2375	2.6e+02	13.0	Protein of unknown function (DUF2375)
3	PF00151 Lipase	1.4e-100	348.5	Lipase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000273371

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000308258	0.942	Phosphatidylserine synthase 2
2	9606.ENSP00000324944	0.936	Lysophospholipid acyltransferase 1
3	9606.ENSP00000371586	0.931	Phosphatidylserine decarboxylase proenzyme, mitochondrial
4	9606.ENSP00000430548	0.929	Phosphatidylserine synthase 1
5	9606.ENSP00000261407	0.917	Lysophospholipid acyltransferase 5
6	9606.ENSP00000302177	0.912	Lysophospholipid acyltransferase 2
7	9606.ENSP00000317300	0.908	Lysophospholipid acyltransferase LPCAT4
8	9606.ENSP00000255078	0.767	DNA-binding protein SMUBP-2
9	9606.ENSP00000274849	0.764	Activator of basal transcription 1
10	9606.ENSP00000260264	0.739	POU domain, class 2, transcription factor 3
11	9606.ENSP00000348510	0.644	General transcription factor 3C polypeptide 1
12	9606.ENSP00000297785	0.636	Retinal dehydrogenase 1
13	9606.ENSP00000295887	0.620	Phosphatidate cytidylyltransferase 1
14	9606.ENSP00000215832	0.602	Mitogen-activated protein kinase 1
15	9606.ENSP00000263025	0.600	Mitogen-activated protein kinase 3
16	9606.ENSP00000264005	0.599	Phosphatidylcholine-sterol acyltransferase
17	9606.ENSP00000288078	0.565	L-fucose kinase
18	9606.ENSP00000472546	0.509	Cytosolic phospholipase A2 gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008970	1.000	phospholipase A1 activity
GO:0005488	0.918	binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044238	0.998	primary metabolic process
GO:0006793	0.995	phosphorus metabolic process
GO:0006796	0.994	phosphate-containing compound metabolic process
GO:0046486	0.991	glycerolipid metabolic process
GO:0019637	0.988	organophosphate metabolic process
GO:0006575	0.971	cellular modified amino acid metabolic process
GO:0006644	0.968	phospholipid metabolic process
GO:0006650	0.964	glycerophospholipid metabolic process
GO:0044249	0.313	cellular biosynthetic process
GO:1901576	0.312	organic substance biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0016020	0.970	membrane
GO:0005622	0.965	intracellular anatomical structure
GO:0005737	0.964	cytoplasm
GO:0043231	0.957	intracellular membrane-bounded organelle
GO:0012505	0.767	endomembrane system
GO:0005615	0.618	extracellular space
GO:0031090	0.542	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18689	1.000	a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 2-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+)
EC:3.1.1.32	1.000	phospholipase A1.

[back to server]