StarFunc result for job id Q53H80

User Input

>input (203 residues)
MACGATLKRTLDFDPLLSPASPKRRRCAPLSAPTSAAASPLSAAAATAASFSAAAASPQK
YLRMEPSPFGDVSSRLTTEQILYNIKQEYKRMQKRRHLETSFQQTDPCCTSDAQPHAFLL
SGPASPGTSSAASSPLKKEQPLFTLRQVGMICERLLKEREEKVREEYEEILNTKLAEQYD
AFVKFTHDQIMRRYGEQPASYVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A287BDC1	0.433	0.433	6.312E-27	203	0.980	0.980	A0A287BDC1.pdb.gz	AKIR2_PIG Akirin-2 OS=Sus scrofa OX=9823 GN=AKIRIN2 PE=2 SV=2
2	AFDB:Q6GQB5	0.477	0.522	1.505E-20	181	0.749	0.840	Q6GQB5.pdb.gz	AKIR2_XENLA Akirin-2 OS=Xenopus laevis OX=8355 GN=akirin2.S PE=1 SV=1
3	AFDB:Q9H9L7	0.351	0.368	4.431E-14	192	0.571	0.604	Q9H9L7.pdb.gz	AKIR1_HUMAN Akirin-1 OS=Homo sapiens OX=9606 GN=AKIRIN1 PE=1 SV=1
4	AFDB:Q9VS59	0.356	0.359	6.712E-10	201	0.399	0.403	Q9VS59.pdb.gz	AKIRN_DROME Akirin OS=Drosophila melanogaster OX=7227 GN=akirin PE=1 SV=1
5	AFDB:Q966L3	0.291	0.273	7.271E-5	218	0.281	0.261	Q966L3.pdb.gz	AKIRN_CAEEL Akirin OS=Caenorhabditis elegans OX=6239 GN=akir-1 PE=1 SV=1
6	AFDB:Q9FNB9	0.227	0.158	1.540E-1	315	0.177	0.114	Q9FNB9.pdb.gz	Q9FNB9_ARATH Basic leucine zipper transcription factor OS=Arabidopsis thaliana OX=3702 GN=bzip13 PE=1 SV=1
7	AFDB:Q9VA18	0.201	0.187	1.540E-1	223	0.153	0.139	Q9VA18.pdb.gz	Q9VA18_DROME Coiled-coil-helix-coiled-coil-helix domain containing 3 OS=Drosophila melanogaster OX=7227 GN=Chchd3 PE=1 SV=1
8	AFDB:M9PG25	0.246	0.092	2.189E-1	568	0.167	0.060	M9PG25.pdb.gz	M9PG25_DROME Bub3 interacting GLEBS and zinc finger domain protein, isoform E OS=Drosophila melanogaster OX=7227 GN=BuGZ PE=1 SV=1
9	AFDB:Q59XM1	0.240	0.069	2.519E-1	791	0.187	0.048	Q59XM1.pdb.gz	EXO84_CANAL Exocyst complex component EXO84 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EXO84 PE=3 SV=3
10	AFDB:O43166	0.288	0.037	2.702E-1	1804	0.158	0.018	O43166.pdb.gz	SI1L1_HUMAN Signal-induced proliferation-associated 1-like protein 1 OS=Homo sapiens OX=9606 GN=SIPA1L1 PE=1 SV=4
11	PDB:7dvqR	0.231	0.197	2.691	241	0.118	0.100	7dvqR.pdb.gz	Structure of the activated human minor spliceosome.
12	PDB:7mqaNA	0.145	0.101	4.720	295	0.099	0.068	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:8dh6b	0.101	0.088	7.719	236	0.025	0.021	8dh6b.pdb.gz	Cryo-EM structure of Saccharomyces cerevisiae cytochrome c oxidase (Complex IV) extracted in lipid nanodiscs
14	PDB:5wlcST	0.139	0.063	8.280	599	0.123	0.042	5wlcST.pdb.gz	The complete structure of the small-subunit processome.
15	PDB:6qw65X	0.182	0.066	8.883	583	0.059	0.021	6qw65X.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q53H80	6.35e-149	413	203	1.000	1.000	AKIR2_HUMAN Akirin-2 OS=Homo sapiens OX=9606 GN=AKIRIN2 PE=1 SV=2
2	A0A287BDC1	2.04e-146	407	203	0.985	0.985	AKIR2_PIG Akirin-2 OS=Sus scrofa OX=9823 GN=AKIRIN2 PE=2 SV=2
3	Q25C79	1.57e-106	306	201	0.931	0.940	AKIR2_RAT Akirin-2 OS=Rattus norvegicus OX=10116 GN=Akirin2 PE=1 SV=1
4	B1AXD8	3.34e-106	305	201	0.931	0.940	AKIR2_MOUSE Akirin-2 OS=Mus musculus OX=10090 GN=Akirin2 PE=1 SV=1
5	Q6GQB5	1.82e-105	302	181	0.749	0.840	AKIR2_XENLA Akirin-2 OS=Xenopus laevis OX=8355 GN=akirin2.S PE=1 SV=1
6	Q9H9L7	1.56e-69	212	192	0.562	0.594	AKIR1_HUMAN Akirin-1 OS=Homo sapiens OX=9606 GN=AKIRIN1 PE=1 SV=1
7	Q99LF1	7.71e-68	207	191	0.567	0.602	AKIR1_MOUSE Akirin-1 OS=Mus musculus OX=10090 GN=Akirin1 PE=1 SV=1
8	H0YEQ5	2.68e-36	125	130	0.315	0.492	H0YEQ5_HUMAN Akirin 1 (Fragment) OS=Homo sapiens OX=9606 GN=AKIRIN1 PE=1 SV=1
9	Q9VS59	2.62e-35	125	201	0.409	0.413	AKIRN_DROME Akirin OS=Drosophila melanogaster OX=7227 GN=akirin PE=1 SV=1
10	Q966L3	2.94e-14	70.5	218	0.315	0.294	AKIRN_CAEEL Akirin OS=Caenorhabditis elegans OX=6239 GN=akir-1 PE=1 SV=1
11	O77375	0.39	33.9	2457	0.103	0.009	O77375_PLAF7 DNA-directed RNA polymerase subunit OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0318200 PE=3 SV=1
12	Q10237	0.51	33.5	638	0.232	0.074	YD14_SCHPO Uncharacterized protein C4G9.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4G9.04c PE=4 SV=1
13	Q27607	2.4	31.6	1145	0.084	0.015	DPOG1_DROME DNA polymerase subunit gamma-1, mitochondrial OS=Drosophila melanogaster OX=7227 GN=PolG1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000015837

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000005008	0.702	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
2	61853.ENSNLEP00000005368	0.702	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
3	61853.ENSNLEP00000021627	0.702	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1
4	61853.ENSNLEP00000004087	0.679	NFKB inhibitor zeta
5	61853.ENSNLEP00000008089	0.672	Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta
6	61853.ENSNLEP00000016247	0.667	Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1
7	61853.ENSNLEP00000018358	0.667	Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100)
8	61853.ENSNLEP00000015866	0.623	mRNA-capping enzyme
9	61853.ENSNLEP00000015677	0.605	Zinc finger protein 292
10	61853.ENSNLEP00000015757	0.605	arginyl-tRNA synthetase 2, mitochondrial
11	61853.ENSNLEP00000016981	0.575	DNA methyltransferase 1 associated protein 1
12	61853.ENSNLEP00000015896	0.559	Gamma-aminobutyric acid (GABA) A receptor, rho 1
13	61853.ENSNLEP00000022160	0.559	MIS12 kinetochore complex component
14	61853.ENSNLEP00000010283	0.530	Splicing factor, suppressor of white-apricot family
15	61853.ENSNLEP00000010310	0.530	Heterogeneous nuclear ribonucleoprotein R
16	61853.ENSNLEP00000015826	0.528	Origin recognition complex, subunit 3
17	61853.ENSNLEP00000015654	0.517	Synaptotagmin binding, cytoplasmic RNA interacting protein
18	61853.ENSNLEP00000022015	0.500	ERCC excision repair 6 like, spindle assembly checkpoint helicase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030674	0.999	protein-macromolecule adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.981	regulation of cellular process
GO:0009987	0.959	cellular process
GO:0019222	0.915	regulation of metabolic process
GO:0060255	0.847	regulation of macromolecule metabolic process
GO:0071704	0.808	organic substance metabolic process
GO:0044238	0.803	primary metabolic process
GO:0006807	0.751	nitrogen compound metabolic process
GO:0051171	0.729	regulation of nitrogen compound metabolic process
GO:0048518	0.714	positive regulation of biological process
GO:0043170	0.692	macromolecule metabolic process
GO:0044237	0.667	cellular metabolic process
GO:0080090	0.666	regulation of primary metabolic process
GO:0031323	0.664	regulation of cellular metabolic process
GO:0010468	0.644	regulation of gene expression
GO:0019219	0.499	regulation of nucleobase-containing compound metabolic process
GO:0050896	0.483	response to stimulus
GO:0048519	0.426	negative regulation of biological process
GO:0051147	0.421	regulation of muscle cell differentiation
GO:0051179	0.420	localization
GO:0009893	0.407	positive regulation of metabolic process
GO:0009889	0.406	regulation of biosynthetic process
GO:1901564	0.394	organonitrogen compound metabolic process
GO:0048522	0.331	positive regulation of cellular process
GO:0048583	0.315	regulation of response to stimulus
GO:0051234	0.307	establishment of localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0032991	0.990	protein-containing complex
GO:0005737	0.990	cytoplasm
GO:0016020	0.988	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]