StarFunc result for job id Q53HC5

User Input

>input (615 residues)
MAESGGSSGGAGGGGAFGAGPGPERPNSTADKNGALKCTFSAPSHSTSLLQGLATLRAQG
QLLDVVLTINREAFPAHKVVLAACSDYFRAMFTGGMREASQDVIELKGVSARGLRHIIDF
AYSAEVTLDLDCVQDVLGAAVFLQMLPVVELCEEFLKAAMSVETCLNIGQMATTFSLASL
RESVDAFTFRHFLQIAEEEDFLRLPLERLVFFLQSNRLQSCAEIDLFRAAVRWLQHDPAR
RPRASHVLCHIRFPLMQSSELVDSVQTLDIMVEDVLCRQYLLEAFNYQVLPFRQHEMQSP
RTAVRSDVPSLVTFGGTPYTDSDRSVSSKVYQLPEPGARHFRELTEMEVGCSHTCVAVLD
NFVYVAGGQHLQYRSGEGAVDACYRYDPHLNRWLRLQAMQESRIQFQLNVLCGMVYATGG
RNRAGSLASVERYCPRRNEWGYACSLKRRTWGHAGAASGGRLYISGGYGISVEDKKALHC
YDPVADQWEFKAPMSEPRVLHAMVGAGGRIYALGGRMDHVDRCFDVLAVEYYVPETDQWT
SVSPMRAGQSEAGCCLLERKIYIVGGYNWRLNNVTGIVQVYNTDTDEWERDLHFPESFAG
IACAPVLLPRAGTRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q53HC5	1.000	1.000	0.000	615	1.000	1.000	Q53HC5.pdb.gz	KLH26_HUMAN Kelch-like protein 26 OS=Homo sapiens OX=9606 GN=KLHL26 PE=1 SV=2
2	AFDB:Q9P2N7	0.865	0.814	2.060E-70	655	0.403	0.379	Q9P2N7.pdb.gz	KLH13_HUMAN Kelch-like protein 13 OS=Homo sapiens OX=9606 GN=KLHL13 PE=1 SV=3
3	AFDB:Q8N4N3	0.850	0.848	1.291E-65	616	0.340	0.339	Q8N4N3.pdb.gz	KLH36_HUMAN Kelch-like protein 36 OS=Homo sapiens OX=9606 GN=KLHL36 PE=1 SV=1
4	AFDB:Q8BWA5	0.791	0.770	1.594E-63	634	0.319	0.309	Q8BWA5.pdb.gz	KLH31_MOUSE Kelch-like protein 31 OS=Mus musculus OX=10090 GN=Klhl31 PE=1 SV=1
5	AFDB:Q53GT1	0.751	0.731	7.290E-60	634	0.322	0.312	Q53GT1.pdb.gz	KLH22_HUMAN Kelch-like protein 22 OS=Homo sapiens OX=9606 GN=KLHL22 PE=1 SV=2
6	AFDB:Q69ZK5	0.652	0.637	4.554E-59	630	0.345	0.337	Q69ZK5.pdb.gz	KLH14_MOUSE Kelch-like protein 14 OS=Mus musculus OX=10090 GN=Klhl14 PE=1 SV=2
7	AFDB:Q96NJ5	0.715	0.710	1.778E-57	620	0.315	0.313	Q96NJ5.pdb.gz	KLH32_HUMAN Kelch-like protein 32 OS=Homo sapiens OX=9606 GN=KLHL32 PE=1 SV=2
8	AFDB:Q9VUU5	0.590	0.584	5.926E-57	623	0.302	0.299	Q9VUU5.pdb.gz	KLHDB_DROME Kelch-like protein diablo OS=Drosophila melanogaster OX=7227 GN=dbo PE=1 SV=1
9	AFDB:Q9Y2M5	0.462	0.466	2.704E-56	609	0.299	0.302	Q9Y2M5.pdb.gz	KLH20_HUMAN Kelch-like protein 20 OS=Homo sapiens OX=9606 GN=KLHL20 PE=1 SV=4
10	AFDB:Q96M94	0.852	0.867	4.568E-55	604	0.294	0.300	Q96M94.pdb.gz	KLH15_HUMAN Kelch-like protein 15 OS=Homo sapiens OX=9606 GN=KLHL15 PE=1 SV=2
11	PDB:5gqtA	0.347	0.448	2.532E-17	470	0.091	0.119	5gqtA.pdb.gz
12	PDB:5gq0A	0.359	0.631	6.166E-17	338	0.081	0.148	5gq0A.pdb.gz
13	PDB:2uvkB	0.376	0.637	2.168E-15	349	0.091	0.160	2uvkB.pdb.gz
14	PDB:2zwaB	0.357	0.323	4.287E-13	683	0.070	0.063	2zwaB.pdb.gz	Structural basis of tRNA modification with CO2 fixation and methylation by wybutosine synthesizing enzyme TYW4.
15	PDB:2hqsA	0.299	0.417	2.419E-8	412	0.033	0.049	2hqsA.pdb.gz
16	PDB:7mq8LR	0.254	0.210	8.065E-8	773	0.057	0.045	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:6wcqC	0.183	0.811	1.104E-7	130	0.068	0.323	6wcqC.pdb.gz
18	PDB:7z8bF	0.273	0.349	1.361E-7	457	0.065	0.088	7z8bF.pdb.gz	Structure of CRL7 FBXW8 reveals coupling with CUL1-RBX1/ROC1 for multi-cullin-RING E3-catalyzed ubiquitin ligation.
19	PDB:2h9lA	0.300	0.518	1.769E-7	321	0.057	0.109	2h9lA.pdb.gz
20	PDB:5o9zL	0.290	0.371	3.493E-7	459	0.085	0.113	5o9zL.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q53HC5	0.0	1274	615	1.000	1.000	KLH26_HUMAN Kelch-like protein 26 OS=Homo sapiens OX=9606 GN=KLHL26 PE=1 SV=2
2	Q9P2N7	1.42e-166	492	655	0.407	0.382	KLH13_HUMAN Kelch-like protein 13 OS=Homo sapiens OX=9606 GN=KLHL13 PE=1 SV=3
3	Q9P2J3	3.38e-164	484	617	0.398	0.397	KLHL9_HUMAN Kelch-like protein 9 OS=Homo sapiens OX=9606 GN=KLHL9 PE=1 SV=2
4	Q8N4N3	5.87e-125	384	616	0.346	0.346	KLH36_HUMAN Kelch-like protein 36 OS=Homo sapiens OX=9606 GN=KLHL36 PE=1 SV=1
5	Q9H511	1.02e-122	378	634	0.335	0.325	KLH31_HUMAN Kelch-like protein 31 OS=Homo sapiens OX=9606 GN=KLHL31 PE=2 SV=1
6	Q8BWA5	1.01e-120	373	634	0.332	0.322	KLH31_MOUSE Kelch-like protein 31 OS=Mus musculus OX=10090 GN=Klhl31 PE=1 SV=1
7	Q9P2G3	1.69e-102	326	628	0.343	0.336	KLH14_HUMAN Kelch-like protein 14 OS=Homo sapiens OX=9606 GN=KLHL14 PE=1 SV=2
8	Q69ZK5	2.23e-102	325	630	0.345	0.337	KLH14_MOUSE Kelch-like protein 14 OS=Mus musculus OX=10090 GN=Klhl14 PE=1 SV=2
9	Q53GT1	1.23e-97	313	634	0.320	0.311	KLH22_HUMAN Kelch-like protein 22 OS=Homo sapiens OX=9606 GN=KLHL22 PE=1 SV=2
10	Q99JN2	1.49e-94	305	634	0.315	0.306	KLH22_MOUSE Kelch-like protein 22 OS=Mus musculus OX=10090 GN=Klhl22 PE=1 SV=1
11	Q96M94	1.52e-92	299	604	0.301	0.306	KLH15_HUMAN Kelch-like protein 15 OS=Homo sapiens OX=9606 GN=KLHL15 PE=1 SV=2
12	Q96NJ5	6.84e-87	285	620	0.319	0.316	KLH32_HUMAN Kelch-like protein 32 OS=Homo sapiens OX=9606 GN=KLHL32 PE=1 SV=2
13	Q9Y2M5	8.24e-84	276	609	0.286	0.289	KLH20_HUMAN Kelch-like protein 20 OS=Homo sapiens OX=9606 GN=KLHL20 PE=1 SV=4
14	Q9VUU5	2.78e-80	267	623	0.304	0.300	KLHDB_DROME Kelch-like protein diablo OS=Drosophila melanogaster OX=7227 GN=dbo PE=1 SV=1
15	Q96PQ7	4.73e-78	265	755	0.289	0.236	KLHL5_HUMAN Kelch-like protein 5 OS=Homo sapiens OX=9606 GN=KLHL5 PE=1 SV=3
16	Q8JZP3	1.14e-77	259	593	0.283	0.293	KLHL2_MOUSE Kelch-like protein 2 OS=Mus musculus OX=10090 GN=Klhl2 PE=2 SV=1
17	O95198	1.33e-75	254	593	0.281	0.292	KLHL2_HUMAN Kelch-like protein 2 OS=Homo sapiens OX=9606 GN=KLHL2 PE=1 SV=2
18	Q9UH77	1.43e-75	254	587	0.278	0.291	KLHL3_HUMAN Kelch-like protein 3 OS=Homo sapiens OX=9606 GN=KLHL3 PE=1 SV=2
19	E0CZ16	2.38e-75	253	587	0.281	0.295	KLHL3_MOUSE Kelch-like protein 3 OS=Mus musculus OX=10090 GN=Klhl3 PE=1 SV=2
20	O94889	6.18e-74	249	574	0.272	0.291	KLH18_HUMAN Kelch-like protein 18 OS=Homo sapiens OX=9606 GN=KLHL18 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07707 BACK	4.7e-22	89.4	BTB And C-terminal Kelch
2	PF00651 BTB	1.2e-24	98.0	BTB/POZ domain
3	PF01344 Kelch_1	6.1e-29	110.7	Kelch motif
4	PF07646 Kelch_2	1.2e-10	52.2	Kelch motif
5	PF13415 Kelch_3	6.3e-10	50.4	Galactose oxidase, central domain
6	PF13418 Kelch_4	4e-11	54.0	Galactose oxidase, central domain
7	PF13854 Kelch_5	0.00048	31.1	Kelch motif
8	PF13964 Kelch_6	1.7e-26	102.8	Kelch motif
9	PF13570 PQQ_3	98	14.9	PQQ-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000300976

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352314	0.632	Kelch-like protein 14
2	9606.ENSP00000259607	0.621	C-C motif chemokine 21
3	9606.ENSP00000386174	0.614	Olfactory receptor 2A12
4	9606.ENSP00000322609	0.608	Glutamate-rich protein 3
5	9606.ENSP00000318029	0.597	Outer dense fiber of sperm tails 3 like 2
6	9606.ENSP00000269878	0.562	Calcium and integrin binding family member 3
7	9606.ENSP00000404220	0.557	Protein KASH5
8	9606.ENSP00000312399	0.545	Coiled-coil domain-containing protein 63
9	9606.ENSP00000301050	0.538	Voltage-dependent L-type calcium channel subunit beta-3
10	9606.ENSP00000357547	0.537	Nuclear pore membrane glycoprotein 210-like
11	9606.ENSP00000264414	0.535	Cullin-3
12	9606.ENSP00000366390	0.517	Speedy protein C
13	9606.ENSP00000359454	0.510	Probable ATP-dependent DNA helicase HFM1
14	9606.ENSP00000476253	0.506	Serine/arginine repetitive matrix 5
15	9606.ENSP00000413632	0.500	Minichromosome maintenance domain-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0009987	0.966	cellular process
GO:0071704	0.948	organic substance metabolic process
GO:0044238	0.944	primary metabolic process
GO:0006807	0.930	nitrogen compound metabolic process
GO:0043170	0.924	macromolecule metabolic process
GO:0070647	0.909	protein modification by small protein conjugation or removal
GO:0032446	0.886	protein modification by small protein conjugation
GO:0016567	0.770	protein ubiquitination
GO:0051726	0.757	regulation of cell cycle
GO:0044237	0.511	cellular metabolic process
GO:0019222	0.507	regulation of metabolic process
GO:0060255	0.457	regulation of macromolecule metabolic process
GO:0050896	0.450	response to stimulus
GO:0048519	0.418	negative regulation of biological process
GO:0031323	0.412	regulation of cellular metabolic process
GO:0080090	0.410	regulation of primary metabolic process
GO:0051171	0.409	regulation of nitrogen compound metabolic process
GO:0048523	0.403	negative regulation of cellular process
GO:0048518	0.356	positive regulation of biological process
GO:0051716	0.342	cellular response to stimulus
GO:0048522	0.338	positive regulation of cellular process
GO:0010564	0.304	regulation of cell cycle process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.969	cytosol
GO:0032991	0.965	protein-containing complex
GO:0043228	0.945	non-membrane-bounded organelle
GO:0043232	0.940	intracellular non-membrane-bounded organelle
GO:1902494	0.937	catalytic complex
GO:1990234	0.933	transferase complex
GO:0031461	0.921	cullin-RING ubiquitin ligase complex
GO:0031463	0.907	Cul3-RING ubiquitin ligase complex
GO:0016020	0.800	membrane
GO:0005856	0.741	cytoskeleton
GO:0043227	0.713	membrane-bounded organelle
GO:0043231	0.673	intracellular membrane-bounded organelle
GO:0015630	0.647	microtubule cytoskeleton
GO:0099512	0.415	supramolecular fiber
GO:0005634	0.373	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]