StarFunc result for job id Q53HV7

User Input

>input (270 residues)
MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEY
AWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQE
HPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFHHCFVHNLCPLLFLAPSGRNLTPA
ELPAKQREQLLGICDAALCRQVQLLGVRLVVGVGRLAEQRARRALAGLMPEVQVEGLLHP
SPRNPQANKGWEAVAKERLNELGLLPLLLK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RAZ8	0.916	0.916	1.473E-53	270	1.000	1.000	A0A024RAZ8.pdb.gz	A0A024RAZ8_HUMAN Single-strand-selective monofunctional uracil-DNA glycosylase 1 isoform 2 OS=Homo sapiens OX=9606 GN=SMUG1 PE=2 SV=1
2	AFDB:Q59I47	0.917	0.910	6.459E-50	272	0.885	0.879	Q59I47.pdb.gz	SMUG1_BOVIN Single-strand selective monofunctional uracil DNA glycosylase OS=Bos taurus OX=9913 GN=SMUG1 PE=2 SV=1
3	AFDB:Q811Q1	0.913	0.887	4.355E-49	278	0.870	0.845	Q811Q1.pdb.gz	SMUG1_RAT Single-strand selective monofunctional uracil-DNA glycosylase OS=Rattus norvegicus OX=10116 GN=Smug1 PE=2 SV=1
4	AFDB:D6RI04	0.484	0.787	1.341E-19	159	0.589	1.000	D6RI04.pdb.gz	D6RI04_HUMAN Single-strand-selective monofunctional uracil-DNA glycosylase 1 OS=Homo sapiens OX=9606 GN=SMUG1 PE=1 SV=1
5	AFDB:A0A0S2Z526	0.488	0.732	4.516E-19	177	0.511	0.780	A0A0S2Z526.pdb.gz	A0A0S2Z526_HUMAN Single-strand-selective monofunctional uracil-DNA glycosylase 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=SMUG1 PE=2 SV=1
6	AFDB:D6RAI1	0.279	0.591	3.286E-11	126	0.381	0.817	D6RAI1.pdb.gz	D6RAI1_HUMAN Single-strand-selective monofunctional uracil-DNA glycosylase 1 OS=Homo sapiens OX=9606 GN=SMUG1 PE=1 SV=1
7	AFDB:O28007	0.435	0.567	8.847E-5	199	0.156	0.211	O28007.pdb.gz	UDGA_ARCFU Type-4 uracil-DNA glycosylase OS=Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) OX=224325 GN=afung PE=1 SV=1
8	PDB:1l9gA	0.416	0.560	9.107E-5	191	0.137	0.194	1l9gA.pdb.gz	Characterization of the full length uracil-DNA glycosylase in the extreme thermophile Thermotoga Maritima
9	AFDB:Q97WF1	0.420	0.510	1.252E-4	216	0.133	0.167	Q97WF1.pdb.gz	UDGA_SACS2 Type-4 uracil-DNA glycosylase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=udg1 PE=1 SV=1
10	AFDB:Q8ZXE0	0.394	0.459	1.988E-4	226	0.148	0.177	Q8ZXE0.pdb.gz	UDGB_PYRAE Type-5 uracil-DNA glycosylase OS=Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2) OX=178306 GN=PAE1327 PE=1 SV=1
11	PDB:1ui0A	0.389	0.517	2.298E-4	192	0.144	0.203	1ui0A.pdb.gz	Crystal Structure of a Family 4 Uracil-DNA Glycosylase from Thermus thermophilus HB8
12	PDB:2d3yA	0.422	0.511	6.141E-4	219	0.181	0.224	2d3yA.pdb.gz	Crystal structure of family 5 uracil-DNA glycosylase bound to DNA.
13	AFDB:Q96YD0	0.440	0.525	7.097E-4	220	0.141	0.173	Q96YD0.pdb.gz	UDGA_SULTO Type-4 uracil-DNA glycosylase OS=Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) OX=273063 GN=STK_22380 PE=1 SV=1
14	PDB:1lqjC	0.370	0.420	4.141E-3	229	0.159	0.188	1lqjC.pdb.gz
15	PDB:4od8B	0.289	0.342	1.660E-2	221	0.133	0.163	4od8B.pdb.gz
16	PDB:1mwiA	0.348	0.529	2.636E-2	165	0.111	0.182	1mwiA.pdb.gz	Crystal structure of a G:T/U mismatch-specific DNA glycosylase: mismatch recognition by complementary-strand interactions.
17	PDB:7rorB	0.230	0.185	7.465E-2	362	0.119	0.088	7rorB.pdb.gz	Reaction hijacking of tyrosine tRNA synthetase as a new whole-of-life-cycle antimalarial strategy.
18	PDB:5x55A	0.332	0.326	7.910E-2	276	0.111	0.109	5x55A.pdb.gz
19	PDB:3dt9A	0.260	0.306	9.408E-2	212	0.111	0.142	3dt9A.pdb.gz	Crystal structures of brain group-VIII phospholipase A2 in nonaged complexes with the organophosphorus nerve agents soman and sarin.
20	PDB:6y4zA	0.241	0.281	9.969E-2	221	0.126	0.154	6y4zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024RAZ8	0.0	538	270	1.000	1.000	A0A024RAZ8_HUMAN Single-strand-selective monofunctional uracil-DNA glycosylase 1 isoform 2 OS=Homo sapiens OX=9606 GN=SMUG1 PE=2 SV=1
2	Q53HV7	0.0	538	270	1.000	1.000	SMUG1_HUMAN Single-strand selective monofunctional uracil DNA glycosylase OS=Homo sapiens OX=9606 GN=SMUG1 PE=1 SV=2
3	Q811Q1	3.90e-163	455	278	0.837	0.813	SMUG1_RAT Single-strand selective monofunctional uracil-DNA glycosylase OS=Rattus norvegicus OX=10116 GN=Smug1 PE=2 SV=1
4	Q59I47	2.53e-155	435	272	0.848	0.842	SMUG1_BOVIN Single-strand selective monofunctional uracil DNA glycosylase OS=Bos taurus OX=9913 GN=SMUG1 PE=2 SV=1
5	D6RA78	5.16e-124	352	172	0.637	1.000	D6RA78_HUMAN Single-strand-selective monofunctional uracil-DNA glycosylase 1 (Fragment) OS=Homo sapiens OX=9606 GN=SMUG1 PE=1 SV=1
6	D6RI04	5.41e-94	275	159	0.500	0.849	D6RI04_HUMAN Single-strand-selective monofunctional uracil-DNA glycosylase 1 OS=Homo sapiens OX=9606 GN=SMUG1 PE=1 SV=1
7	A0A0S2Z526	2.48e-93	274	177	0.500	0.763	A0A0S2Z526_HUMAN Single-strand-selective monofunctional uracil-DNA glycosylase 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=SMUG1 PE=2 SV=1
8	D6RA25	1.37e-73	222	108	0.400	1.000	D6RA25_HUMAN Single-strand-selective monofunctional uracil-DNA glycosylase 1 (Fragment) OS=Homo sapiens OX=9606 GN=SMUG1 PE=1 SV=1
9	D6RAI1	8.42e-64	197	126	0.381	0.817	D6RAI1_HUMAN Single-strand-selective monofunctional uracil-DNA glycosylase 1 OS=Homo sapiens OX=9606 GN=SMUG1 PE=1 SV=1
10	D6RAS0	6.00e-63	194	95	0.352	1.000	D6RAS0_HUMAN Single-strand-selective monofunctional uracil-DNA glycosylase 1 (Fragment) OS=Homo sapiens OX=9606 GN=SMUG1 PE=1 SV=8
11	D6RIA4	5.13e-59	184	90	0.333	1.000	D6RIA4_HUMAN Single-strand-selective monofunctional uracil-DNA glycosylase 1 (Fragment) OS=Homo sapiens OX=9606 GN=SMUG1 PE=1 SV=1
12	D6RD88	1.45e-52	167	82	0.304	1.000	D6RD88_HUMAN Single-strand-selective monofunctional uracil-DNA glycosylase 1 (Fragment) OS=Homo sapiens OX=9606 GN=SMUG1 PE=1 SV=1
13	Q08562	8.2	30.4	1619	0.059	0.010	ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ULS1 PE=1 SV=1
14	O14343	8.4	30.4	883	0.048	0.015	KLP5_SCHPO Kinesin-like protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=klp5 PE=1 SV=1
15	Q8LGI3	8.4	30.0	318	0.133	0.113	ARC2A_ARATH Actin-related protein 2/3 complex subunit 2A OS=Arabidopsis thaliana OX=3702 GN=ARPC2A PE=1 SV=1
16	A0A2R8YDM2	8.6	30.4	965	0.067	0.019	A0A2R8YDM2_HUMAN Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1 PE=1 SV=1
17	C9JMB8	8.6	30.4	972	0.067	0.019	C9JMB8_HUMAN Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1 PE=1 SV=2
18	E5KLJ9	8.6	30.4	979	0.067	0.018	E5KLJ9_HUMAN Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1 PE=1 SV=1
19	O60313	8.6	30.4	960	0.067	0.019	OPA1_HUMAN Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1 PE=1 SV=3
20	Q8T6H3	9.2	30.4	1351	0.089	0.018	ABCC6_DICDI ABC transporter C family member 6 OS=Dictyostelium discoideum OX=44689 GN=abcC6 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16265 DUF4918	0.015	26.4	Domain of unknown function (DUF4918)
2	PF03167 UDG	0.023	26.2	Uracil DNA glycosylase superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000424191

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216714	0.932	DNA-(apurinic or apyrimidinic site) lyase
2	9606.ENSP00000242576	0.912	Uracil-DNA glycosylase
3	9606.ENSP00000376611	0.912	G/T mismatch-specific thymine DNA glycosylase
4	9606.ENSP00000249910	0.859	Methyl-CpG-binding domain protein 4
5	9606.ENSP00000219066	0.775	Endonuclease III-like protein 1
6	9606.ENSP00000347170	0.773	Endonuclease 8-like 1
7	9606.ENSP00000306561	0.762	N-glycosylase/DNA lyase
8	9606.ENSP00000282572	0.748	Cyclin-O
9	9606.ENSP00000358563	0.724	H/ACA ribonucleoprotein complex subunit 4
10	9606.ENSP00000284503	0.696	Endonuclease 8-like 2
11	9606.ENSP00000252660	0.649	Proto-oncogene Mas
12	9606.ENSP00000262887	0.631	DNA repair protein XRCC1
13	9606.ENSP00000361170	0.628	Adenine DNA glycosylase
14	9606.ENSP00000362748	0.624	Methylcytosine dioxygenase TET1
15	9606.ENSP00000265421	0.621	DNA polymerase beta
16	9606.ENSP00000305480	0.605	Flap endonuclease 1
17	9606.ENSP00000219431	0.601	DNA-3-methyladenine glycosylase
18	9606.ENSP00000442788	0.574	Methylcytosine dioxygenase TET2
19	9606.ENSP00000237283	0.572	tRNA-specific adenosine deaminase 2
20	9606.ENSP00000256398	0.571	Elongator complex protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004844	1.000	uracil DNA N-glycosylase activity
GO:0005488	0.932	binding
GO:0017065	0.879	single-strand selective uracil DNA N-glycosylase activity
GO:0005515	0.772	protein binding
GO:0000702	0.576	oxidized base lesion DNA N-glycosylase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.998	cellular metabolic process
GO:0044238	0.997	primary metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:1901360	0.995	organic cyclic compound metabolic process
GO:0050896	0.993	response to stimulus
GO:0090304	0.992	nucleic acid metabolic process
GO:0044260	0.991	cellular macromolecule metabolic process
GO:0006281	0.976	DNA repair
GO:1901564	0.968	organonitrogen compound metabolic process
GO:0006284	0.963	base-excision repair
GO:0043412	0.794	macromolecule modification
GO:0006304	0.732	DNA modification
GO:0044248	0.670	cellular catabolic process
GO:1901575	0.663	organic substance catabolic process
GO:0072527	0.654	pyrimidine-containing compound metabolic process
GO:0046700	0.647	heterocycle catabolic process
GO:0044270	0.647	cellular nitrogen compound catabolic process
GO:1901361	0.639	organic cyclic compound catabolic process
GO:0072529	0.572	pyrimidine-containing compound catabolic process
GO:1901135	0.496	carbohydrate derivative metabolic process
GO:0019439	0.465	aromatic compound catabolic process
GO:0034655	0.463	nucleobase-containing compound catabolic process
GO:0055086	0.454	nucleobase-containing small molecule metabolic process
GO:0009219	0.415	pyrimidine deoxyribonucleotide metabolic process
GO:0009166	0.409	nucleotide catabolic process
GO:1901136	0.402	carbohydrate derivative catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0005730	0.998	nucleolus
GO:0001650	0.991	fibrillar center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.2.-	1.000	Hydrolyzing N-glycosyl compounds.

[back to server]