StarFunc result for job id Q53QV2

User Input

>input (105 residues)
MSIYFPIHCPDYLRSAKMTEVMMNTQPMEEIGLSPRKDGLSYQIFPDPSDFDRCCKLKDR
LPSIVVEPTEGEVESGELRWPPEEFLVQEDEQDNCEETAKENKEQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q53QV2	1.000	1.000	2.797E-16	105	1.000	1.000	Q53QV2.pdb.gz	LBH_HUMAN Protein LBH OS=Homo sapiens OX=9606 GN=LBH PE=1 SV=1
2	AFDB:Q7SXH0	0.311	0.334	2.572E-5	95	0.467	0.516	Q7SXH0.pdb.gz	Q7SXH0_DANRE Protein LBH OS=Danio rerio OX=7955 GN=lbh PE=2 SV=1
3	AFDB:Q8I5V8	0.184	0.127	2.638E-1	167	0.143	0.090	Q8I5V8.pdb.gz	Q8I5V8_PLAF7 Mago-binding protein, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1209000 PE=4 SV=1
4	AFDB:Q1G3K8	0.197	0.133	1.188	216	0.143	0.069	Q1G3K8.pdb.gz	RIC7_ARATH CRIB domain-containing protein RIC7 OS=Arabidopsis thaliana OX=3702 GN=RIC7 PE=1 SV=1
5	AFDB:Q8NG41	0.160	0.136	1.459	125	0.152	0.128	Q8NG41.pdb.gz	NPB_HUMAN Neuropeptide B OS=Homo sapiens OX=9606 GN=NPB PE=1 SV=1
6	AFDB:Q09802	0.168	0.135	1.919	140	0.143	0.107	Q09802.pdb.gz	YAAB_SCHPO UPF0654 protein C22G7.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC22G7.11c PE=3 SV=2
7	AFDB:Q8BUA2	0.169	0.066	1.919	528	0.152	0.030	Q8BUA2.pdb.gz	Q8BUA2_MOUSE Fibronectin type-III domain-containing protein OS=Mus musculus OX=10090 GN=Abi3bp PE=2 SV=1
8	AFDB:Q9FL44	0.126	0.077	2.522	235	0.162	0.072	Q9FL44.pdb.gz	MPH1_ARATH Protein MAINTENANCE OF PSII UNDER HIGH LIGHT 1 OS=Arabidopsis thaliana OX=3702 GN=MPH1 PE=1 SV=1
9	AFDB:Q9M3B8	0.173	0.053	2.701	597	0.171	0.030	Q9M3B8.pdb.gz	PHIP1_ARATH Phragmoplastin interacting protein 1 OS=Arabidopsis thaliana OX=3702 GN=PHIP1 PE=1 SV=1
10	AFDB:Q8IFN2	0.181	0.102	2.892	217	0.143	0.069	Q8IFN2.pdb.gz	Q8IFN2_PLAF7 Apical asparagine-rich protein AARP OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0423400 PE=4 SV=1
11	PDB:7ktrE	0.204	0.180	3.416	124	0.152	0.129	7ktrE.pdb.gz	Structure of the human SAGA coactivator complex.
12	PDB:4v6wCE	0.152	0.082	6.771	228	0.105	0.048	4v6wCE.pdb.gz	Structures of the human and Drosophila 80S ribosome.
13	PDB:4v6xCR	0.143	0.094	6.771	189	0.067	0.037	4v6xCR.pdb.gz	Structures of the human and Drosophila 80S ribosome.
14	PDB:7z1lQ	0.187	0.164	8.313	123	0.143	0.122	7z1lQ.pdb.gz	Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q53QV2	1.51e-74	217	105	1.000	1.000	LBH_HUMAN Protein LBH OS=Homo sapiens OX=9606 GN=LBH PE=1 SV=1
2	Q9CX60	4.99e-67	198	105	0.905	0.905	LBH_MOUSE Protein LBH OS=Mus musculus OX=10090 GN=Lbh PE=1 SV=1
3	Q7SXH0	6.88e-34	114	95	0.486	0.537	Q7SXH0_DANRE Protein LBH OS=Danio rerio OX=7955 GN=lbh PE=2 SV=1
4	Q9ULK0	1.4	30.0	1009	0.105	0.011	GRID1_HUMAN Glutamate receptor ionotropic, delta-1 OS=Homo sapiens OX=9606 GN=GRID1 PE=2 SV=2
5	Q10013	1.5	29.3	126	0.143	0.119	SMD1_CAEEL Probable small nuclear ribonucleoprotein Sm D1 OS=Caenorhabditis elegans OX=6239 GN=snr-3 PE=3 SV=1
6	Q61627	1.7	29.6	1009	0.105	0.011	GRID1_MOUSE Glutamate receptor ionotropic, delta-1 OS=Mus musculus OX=10090 GN=Grid1 PE=1 SV=2
7	Q62640	1.7	29.6	1009	0.105	0.011	GRID1_RAT Glutamate receptor ionotropic, delta-1 OS=Rattus norvegicus OX=10116 GN=Grid1 PE=1 SV=1
8	P28635	1.9	29.6	271	0.114	0.044	METQ_ECOLI D-methionine-binding lipoprotein MetQ OS=Escherichia coli (strain K12) OX=83333 GN=metQ PE=1 SV=2
9	A0A0R4IY96	6.7	28.1	1023	0.276	0.028	A0A0R4IY96_DANRE Integrator complex subunit 5 OS=Danio rerio OX=7955 GN=ints5 PE=1 SV=1
10	Q8IHM0	8.1	27.7	3119	0.114	0.004	Q8IHM0_PLAF7 Erythrocyte membrane protein 1, PfEMP1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1150400 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15317 Lbh	6e-25	99.3	Cardiac transcription factor regulator, Developmental protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378733

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000295206	0.648	Homeobox protein engrailed-1
2	9606.ENSP00000371061	0.610	UPF0600 protein C5orf51
3	9606.ENSP00000332162	0.537	Steroid receptor-associated and regulated protein
4	9606.ENSP00000302100	0.536	Galectin-4
5	9606.ENSP00000321797	0.508	Fibroblast growth factor 8
6	9606.ENSP00000232978	0.507	NK-tumor recognition protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.982	regulation of cellular process
GO:0048522	0.971	positive regulation of cellular process
GO:0023051	0.969	regulation of signaling
GO:0010646	0.969	regulation of cell communication
GO:0048583	0.962	regulation of response to stimulus
GO:0060255	0.899	regulation of macromolecule metabolic process
GO:0009987	0.888	cellular process
GO:0048519	0.887	negative regulation of biological process
GO:0010468	0.829	regulation of gene expression
GO:0048523	0.791	negative regulation of cellular process
GO:0009889	0.761	regulation of biosynthetic process
GO:0010556	0.748	regulation of macromolecule biosynthetic process
GO:0051252	0.746	regulation of RNA metabolic process
GO:0031326	0.715	regulation of cellular biosynthetic process
GO:0006355	0.707	regulation of DNA-templated transcription
GO:0009966	0.681	regulation of signal transduction
GO:0010604	0.678	positive regulation of macromolecule metabolic process
GO:0009891	0.477	positive regulation of biosynthetic process
GO:0048856	0.474	anatomical structure development
GO:0010557	0.425	positive regulation of macromolecule biosynthetic process
GO:0045893	0.418	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.995	cytoplasm
GO:0032991	0.945	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]