StarFunc result for job id Q53R41

User Input

>input (847 residues)
MKKTPVFLESLVTNMLRLRAICPFSWRVFQFRPISCEPLIIQMNKCTDEEQMFGFIERNK
AILSEKQVGCAFDMLWKLQKQKTSLLKNAEYVRDHPQFLTLHNLATNKFKLMNDDTLVNV
LYVTQQFAGEAHDPLVEALVTEAWRRLERFDIKLLSEFSSCLADQHLYFSPLMGKIADIV
HRNLETTQDLSSLSVLMVNISSLISRHFQQQLVNKTELLFDTIDSSEVNVAKSIAKFLRN
VRYRYQPLLERCNNVFLSNVDHLDLDSISKILSVYKFLQFNSFEFIIMAKKKLTEMIPLC
NHPASFVKLFVALGPIAGPEEKKQLKSTMLLMSEDLTGEQALAVLGAMGDMESRNSCLIK
RVTSVLHKHLDGYKPLELLKITQELTFLHFQRKEFFAKLRELLLSYLKNSFIPTEVSVLV
RAISLLPSPHLDEVGISRIEAVLPQCDLNNLSSFATSVLRWIQHDHMYLDNMTAKQLKLL
QKLDHYGRQRLQHSNSLDLLRKELKSLKGNTFPESLLEEMIATLQHFMDDINYINVGEIA
SFISSTDYLSTLLLDRIASVAVQQIEKIHPFTIPAIIRPFSVLNYDPPQRDEFLGTCVQH
LNSYLGILDPFILVFLGFSLATLEYFPEDLLKAIFNIKFLARLDSQLEILSPSRSARVQF
HLMELNRSVCLECPEFQIPWFHDRFCQQYNKGIGGMDGTQQQIFKMLAEVLGGINCVKAS
VLTPYYHKVDFECILDKRKKPLPYGSHNIALGQLPEMPWESNIEIVGSRLPPGAERIALE
FLDSKALCRNIPHMKGKSAMKKRHLEILGYRVIQISQFEWNSMALSTKDARMDYLRECIF
GEVKSCL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q53R41	1.000	1.000	8.983E-97	847	1.000	1.000	Q53R41.pdb.gz	FAKD1_HUMAN FAST kinase domain-containing protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD1 PE=1 SV=1
2	AFDB:A0A024R3X5	0.288	0.340	6.003E-16	710	0.138	0.165	A0A024R3X5.pdb.gz
3	AFDB:Q91YM4	0.313	0.411	6.156E-15	630	0.142	0.190	Q91YM4.pdb.gz	FAKD4_MOUSE FAST kinase domain-containing protein 4 OS=Mus musculus OX=10090 GN=Tbrg4 PE=1 SV=1
4	AFDB:Q14CZ7	0.303	0.382	7.323E-15	662	0.151	0.193	Q14CZ7.pdb.gz	FAKD3_HUMAN FAST kinase domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD3 PE=1 SV=2
5	AFDB:B4DU42	0.337	0.438	1.807E-14	642	0.143	0.188	B4DU42.pdb.gz	B4DU42_HUMAN cDNA FLJ56153, highly similar to Homo sapiens transforming growth factor beta regulator 4 (TBRG4), transcript variant 1, mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
6	AFDB:Q922E6	0.286	0.348	7.253E-14	689	0.129	0.158	Q922E6.pdb.gz	FAKD2_MOUSE FAST kinase domain-containing protein 2, mitochondrial OS=Mus musculus OX=10090 GN=Fastkd2 PE=2 SV=2
7	AFDB:Q7L8L6	0.326	0.358	5.632E-13	764	0.137	0.152	Q7L8L6.pdb.gz	FAKD5_HUMAN FAST kinase domain-containing protein 5, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD5 PE=1 SV=1
8	AFDB:Q14296	0.315	0.471	1.013E-8	549	0.098	0.151	Q14296.pdb.gz	FASTK_HUMAN Fas-activated serine/threonine kinase OS=Homo sapiens OX=9606 GN=FASTK PE=1 SV=1
9	AFDB:Q57ZX7	0.245	0.357	2.331E-8	516	0.079	0.130	Q57ZX7.pdb.gz	Q57ZX7_TRYB2 Guide RNA binding protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.120 PE=4 SV=1
10	AFDB:Q384R6	0.228	0.188	4.356E-8	1087	0.125	0.098	Q384R6.pdb.gz	Q384R6_TRYB2 Mitochondrial RNA binding complex 1 subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5390 PE=4 SV=1
11	PDB:4m57A	0.225	0.248	1.015E-4	702	0.092	0.111	4m57A.pdb.gz
12	PDB:3s4wB	0.167	0.139	1.340E-4	1146	0.106	0.079	3s4wB.pdb.gz
13	PDB:2xwuB	0.152	0.144	2.180E-4	910	0.128	0.119	2xwuB.pdb.gz
14	PDB:3gb8A	0.138	0.127	2.685E-4	958	0.123	0.109	3gb8A.pdb.gz
15	PDB:6xu2A	0.260	0.212	2.980E-4	1091	0.109	0.084	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
16	PDB:5lqwQ	0.199	0.209	3.671E-4	791	0.079	0.085	5lqwQ.pdb.gz	Molecular architecture of the Saccharomyces cerevisiae activated spliceosome
17	PDB:1xi4A	0.093	0.057	3.935E-4	1630	0.117	0.061	1xi4A.pdb.gz
18	PDB:6q82A	0.128	0.115	4.218E-4	1027	0.113	0.093	6q82A.pdb.gz	Structural basis for the nuclear import and export functions of the biportin Pdr6/Kap122.
19	PDB:6ahoA	0.176	0.166	5.019E-4	916	0.131	0.121	6ahoA.pdb.gz
20	PDB:7kzvV	0.160	0.134	5.019E-4	1155	0.120	0.088	7kzvV.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q53R41	0.0	1748	847	1.000	1.000	FAKD1_HUMAN FAST kinase domain-containing protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD1 PE=1 SV=1
2	Q14CZ7	2.03e-18	92.4	662	0.158	0.202	FAKD3_HUMAN FAST kinase domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD3 PE=1 SV=2
3	Q91YM4	2.21e-12	73.2	630	0.091	0.122	FAKD4_MOUSE FAST kinase domain-containing protein 4 OS=Mus musculus OX=10090 GN=Tbrg4 PE=1 SV=1
4	Q7L8L6	2.11e-11	70.1	764	0.104	0.115	FAKD5_HUMAN FAST kinase domain-containing protein 5, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD5 PE=1 SV=1
5	Q969Z0	2.32e-10	66.6	631	0.089	0.119	FAKD4_HUMAN FAST kinase domain-containing protein 4 OS=Homo sapiens OX=9606 GN=TBRG4 PE=1 SV=1
6	B4DU42	3.03e-10	66.2	642	0.089	0.117	B4DU42_HUMAN cDNA FLJ56153, highly similar to Homo sapiens transforming growth factor beta regulator 4 (TBRG4), transcript variant 1, mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
7	Q9NYY8	2.53e-06	53.5	710	0.076	0.090	FAKD2_HUMAN FAST kinase domain-containing protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD2 PE=1 SV=1
8	Q9JIX9	0.001	44.7	511	0.074	0.123	FASTK_MOUSE Fas-activated serine/threonine kinase OS=Mus musculus OX=10090 GN=Fastk PE=1 SV=1
9	Q922E6	0.004	43.1	689	0.077	0.094	FAKD2_MOUSE FAST kinase domain-containing protein 2, mitochondrial OS=Mus musculus OX=10090 GN=Fastkd2 PE=2 SV=2
10	Q14296	0.19	37.7	549	0.071	0.109	FASTK_HUMAN Fas-activated serine/threonine kinase OS=Homo sapiens OX=9606 GN=FASTK PE=1 SV=1
11	Q9FIZ3	0.53	36.6	1252	0.032	0.022	GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana OX=3702 GN=GSO2 PE=1 SV=2
12	Q8R0K2	1.1	35.0	507	0.044	0.073	TRI31_MOUSE E3 ubiquitin-protein ligase TRIM31 OS=Mus musculus OX=10090 GN=Trim31 PE=1 SV=1
13	Q8VZE7	1.6	34.7	671	0.022	0.028	RAP_ARATH RAP domain-containing protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RAP PE=1 SV=1
14	P78527	2.1	34.7	4128	0.035	0.007	PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC PE=1 SV=3
15	Q84MH1	3.0	33.9	640	0.020	0.027	RAP_ORYSJ RAP domain-containing protein, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=AL1 PE=2 SV=1
16	A0A1D8PPL1	4.6	33.5	3821	0.026	0.006	A0A1D8PPL1_CANAL Histone acetyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TRA1 PE=4 SV=1
17	Q4G0X4	4.7	32.7	260	0.028	0.092	KCD21_HUMAN BTB/POZ domain-containing protein KCTD21 OS=Homo sapiens OX=9606 GN=KCTD21 PE=1 SV=1
18	E7F4J7	5.5	33.1	4119	0.037	0.008	E7F4J7_DANRE DNA-dependent protein kinase catalytic subunit OS=Danio rerio OX=7955 GN=prkdc PE=1 SV=1
19	D3ZBE2	8.1	32.7	2459	0.043	0.015	D3ZBE2_RAT acetyl-CoA carboxylase OS=Rattus norvegicus OX=10116 GN=Acacb PE=1 SV=4
20	E9PSQ0	8.8	32.7	2460	0.043	0.015	E9PSQ0_RAT acetyl-CoA carboxylase OS=Rattus norvegicus OX=10116 GN=Acacb PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06743 FAST_1	3.4e-18	76.6	FAST kinase-like protein, subdomain 1
2	PF08368 FAST_2	3.8e-24	96.4	FAST kinase-like protein, subdomain 2
3	PF08373 RAP	1.5e-10	52.3	RAP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000400513

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000297532	0.800	Fas-activated serine/threonine kinase
2	9606.ENSP00000373331	0.621	Mitochondrial mRNA pseudouridine synthase RPUSD3
3	9606.ENSP00000260665	0.578	Leucine-rich PPR motif-containing protein, mitochondrial
4	9606.ENSP00000361982	0.576	Mitochondrial mRNA pseudouridine synthase TRUB2
5	9606.ENSP00000298317	0.568	Mitochondrial RNA pseudouridine synthase RPUSD4
6	9606.ENSP00000361923	0.558	Mitochondrial coiled-coil-helix-coiled-coil-helix domain containing proteins
7	9606.ENSP00000379654	0.549	Meiosis regulator and mRNA stability factor 1
8	9606.ENSP00000254799	0.534	G-rich sequence factor 1
9	9606.ENSP00000370508	0.531	Translation initiation factor IF-3, mitochondrial
10	9606.ENSP00000254630	0.528	Pentatricopeptide repeat domain-containing protein 3, mitochondrial
11	9606.ENSP00000258975	0.514	Translational activator of cytochrome c oxidase 1
12	9606.ENSP00000309595	0.514	Twinkle protein, mitochondrial
13	9606.ENSP00000263063	0.508	Poly(A) RNA polymerase, mitochondrial
14	9606.ENSP00000292478	0.508	Pentatricopeptide repeat-containing protein 1, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0044238	0.994	primary metabolic process
GO:0006807	0.992	nitrogen compound metabolic process
GO:0043170	0.991	macromolecule metabolic process
GO:0065007	0.981	biological regulation
GO:0000959	0.975	mitochondrial RNA metabolic process
GO:0050794	0.972	regulation of cellular process
GO:0060255	0.947	regulation of macromolecule metabolic process
GO:0031323	0.942	regulation of cellular metabolic process
GO:0051171	0.937	regulation of nitrogen compound metabolic process
GO:0080090	0.934	regulation of primary metabolic process
GO:0010468	0.930	regulation of gene expression
GO:0010608	0.890	post-transcriptional regulation of gene expression
GO:0043487	0.825	regulation of RNA stability
GO:0043488	0.813	regulation of mRNA stability
GO:0010467	0.464	gene expression
GO:0140053	0.332	mitochondrial gene expression
GO:0048518	0.314	positive regulation of biological process
GO:0044528	0.301	regulation of mitochondrial mRNA stability

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.978	intracellular organelle lumen
GO:0005759	0.746	mitochondrial matrix
GO:0031981	0.495	nuclear lumen
GO:0005654	0.458	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]