StarFunc result for job id Q53SF7

User Input

>input (1128 residues)
MDGRTPRPQDAPARRKPKAKAPLPPAETKYTDVSSAADSVESTAFIMEQKENMIDKDVEL
SVVLPGDIIKSTTVHGSKPMMDLLIFLCAQYHLNPSSYTIDLLSAEQNHIKFKPNTPIGM
LEVEKVILKPKMLDKKKPTPIIPEKTVRVVINFKKTQKTIVRVSPHASLQELAPIICSKC
EFDPLHTLLLKDYQSQEPLDLTKSLNDLGLRELYAMDVNRESCQISQNLDIMKEKENKGF
FSFFQRSKKKRDQTASAPATPLVNKHRPTFTRSNTISKPYISNTLPSDAPKKRRAPLPPM
PASQSVPQDLAHIQERPASCIVKSMSVDETDKSPCEAGRVRAGSLQLSSMSAGNSSLRRT
KRKAPSPPSKIPPHQSDENSRVTALQPVDGVPPDSASEANSPEELSSPAGISSDYSLEEI
DEKEELSEVPKVEAENISPKSQDIPFVSTDIINTLKNDPDSALGNGSGEFSQNSMEEKQE
TKSTDGQEPHSVVYDTSNGKKVVDSIRNLKSLGPNQENVVQNEIIVYPENTEDNMKNGVK
KTEINVEGVAKNNNIDMEVERPSNSEAHETDTAISYKENHLAASSVPDQKLNQPSAEKTK
DAAIQTTPSCNSFDGKHQDHNLSDSKVEECVQTSNNNISTQHSCLSSQDSVNTSREFRSQ
GTLIIHSEDPLTVKDPICAHGNDDLLPPVDRIDKNSTASYLKNYPLYRQDYNPKPKPSNE
ITREYIPKIGMTTYKIVPPKSLEISKDWQSETIEYKDDQDMHALGKKHTHENVKETAIQT
EDSAISESPEEPLPNLKPKPNLRTEHQVPSSVSSPDDAMVSPLKPAPKMTRDTGTAPFAP
NLEEINNILESKFKSRASNAQAKPSSFFLQMQKRVSGHYVTSAAAKSVHAAPNPAPKELT
NKEAERDMLPSPEQTLSPLSKMPHSVPQPLVEKTDDDVIGQAPAEASPPPIAPKPVTIPA
SQVSTQNLKTLKTFGAPRPYSSSGPSPFALAVVKRSQSFSKERTESPSASALVQPPANTE
EGKTHSVNKFVDIPQLGVSDKENNSAHNEQNSQIPTPTDGPSFTVMRQSSLTFQSSDPEQ
MRQSLLTAIRSGEAAAKLKRVTIPSNTISVNGRSRLSHSMSPDAQDGH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q53SF7	1.000	1.000	0.000	1128	1.000	1.000	Q53SF7.pdb.gz	COBL1_HUMAN Cordon-bleu protein-like 1 OS=Homo sapiens OX=9606 GN=COBLL1 PE=1 SV=3
2	AFDB:D3ZUI5	0.103	0.103	3.052E-32	1133	0.209	0.208	D3ZUI5.pdb.gz	COBL_RAT Protein cordon-bleu OS=Rattus norvegicus OX=10116 GN=Cobl PE=1 SV=1
3	AFDB:O75128	0.102	0.093	3.456E-32	1261	0.224	0.201	O75128.pdb.gz	COBL_HUMAN Protein cordon-bleu OS=Homo sapiens OX=9606 GN=COBL PE=1 SV=2
4	AFDB:Q5NBX1	0.105	0.090	2.088E-31	1337	0.222	0.187	Q5NBX1.pdb.gz	COBL_MOUSE Protein cordon-bleu OS=Mus musculus OX=10090 GN=Cobl PE=1 SV=1
5	AFDB:E7F568	0.102	0.092	2.311E-28	1343	0.240	0.202	E7F568.pdb.gz	COBL_DANRE Protein cordon-bleu OS=Danio rerio OX=7955 GN=cobl PE=1 SV=2
6	PDB:7rbsB	0.066	0.413	9.650E-9	157	0.015	0.108	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
7	PDB:6yvaC	0.064	0.402	1.027E-8	155	0.016	0.116	6yvaC.pdb.gz
8	PDB:6pyuA	0.065	0.078	2.947E-8	930	0.025	0.030	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.
9	PDB:6mdhA	0.063	0.418	7.024E-8	149	0.016	0.121	6mdhA.pdb.gz
10	PDB:5itdA	0.066	0.074	1.306E-7	995	0.025	0.028	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
11	PDB:7lq1A	0.066	0.078	1.479E-7	950	0.023	0.027	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
12	PDB:5dxhD	0.065	0.075	1.674E-7	981	0.027	0.032	5dxhD.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).
13	PDB:2y3aA	0.067	0.077	2.145E-7	976	0.022	0.026	2y3aA.pdb.gz	Structure of Lipid Kinase P110Beta-P85Beta Elucidates an Unusual Sh2-Domain-Mediated Inhibitory Mechanism.
14	PDB:5swpA	0.060	0.064	4.516E-7	1060	0.027	0.029	5swpA.pdb.gz	Identification of allosteric binding sites for PI3K alpha oncogenic mutant specific inhibitor design.
15	PDB:4yknA	0.065	0.061	7.417E-7	1205	0.027	0.026	4yknA.pdb.gz	Discovery of a Potent Class of PI3K alpha Inhibitors with Unique Binding Mode via Encoded Library Technology (ELT).
16	AFDB:Q8SXD4	0.083	0.083	9.304E-7	1122	0.137	0.138	Q8SXD4.pdb.gz	MIDN_DROME Midnolin homolog OS=Drosophila melanogaster OX=7227 GN=stx PE=1 SV=1
17	AFDB:Q8CGM2	0.072	0.047	1.528E-6	1859	0.146	0.089	Q8CGM2.pdb.gz	RP1L1_MOUSE Retinitis pigmentosa 1-like 1 protein OS=Mus musculus OX=10090 GN=Rp1l1 PE=1 SV=1
18	AFDB:Q8IWN7	0.083	0.051	1.730E-6	2400	0.157	0.074	Q8IWN7.pdb.gz	RP1L1_HUMAN Retinitis pigmentosa 1-like 1 protein OS=Homo sapiens OX=9606 GN=RP1L1 PE=1 SV=5
19	AFDB:P35820	0.064	0.050	1.517E-5	1601	0.152	0.107	P35820.pdb.gz	PSC_DROME Polycomb group protein Psc OS=Drosophila melanogaster OX=7227 GN=Psc PE=1 SV=2
20	AFDB:P56716	0.074	0.050	1.104E-4	2095	0.135	0.073	P56716.pdb.gz	RP1_MOUSE Oxygen-regulated protein 1 OS=Mus musculus OX=10090 GN=Rp1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q53SF7	0.0	2300	1128	1.000	1.000	COBL1_HUMAN Cordon-bleu protein-like 1 OS=Homo sapiens OX=9606 GN=COBLL1 PE=1 SV=3
2	O75128	3.25e-51	199	1261	0.105	0.094	COBL_HUMAN Protein cordon-bleu OS=Homo sapiens OX=9606 GN=COBL PE=1 SV=2
3	G5E8P4	9.16e-50	195	1312	0.097	0.083	G5E8P4_MOUSE Cordon-bleu WH2 repeat OS=Mus musculus OX=10090 GN=Cobl PE=1 SV=1
4	E7F568	2.96e-49	193	1343	0.097	0.081	COBL_DANRE Protein cordon-bleu OS=Danio rerio OX=7955 GN=cobl PE=1 SV=2
5	Q5NBX1	7.80e-47	186	1337	0.097	0.082	COBL_MOUSE Protein cordon-bleu OS=Mus musculus OX=10090 GN=Cobl PE=1 SV=1
6	D3ZUI5	1.02e-44	179	1133	0.079	0.079	COBL_RAT Protein cordon-bleu OS=Rattus norvegicus OX=10116 GN=Cobl PE=1 SV=1
7	A0A7P0TAB9	8.46e-44	156	106	0.067	0.717	A0A7P0TAB9_HUMAN COBL-like 1, isoform CRA_d OS=Homo sapiens OX=9606 GN=COBLL1 PE=1 SV=1
8	Q3V090	0.39	37.4	742	0.025	0.038	Q3V090_MOUSE Ras GTPase-activating protein 1 OS=Mus musculus OX=10090 GN=Rasa1 PE=2 SV=1
9	Q3TTA2	0.45	37.0	488	0.025	0.057	Q3TTA2_MOUSE Ras GTPase-activating protein 1 (Fragment) OS=Mus musculus OX=10090 GN=Rasa1 PE=2 SV=1
10	A0A286YDU0	0.47	37.0	497	0.025	0.056	A0A286YDU0_MOUSE RAS p21 protein activator 1 (Fragment) OS=Mus musculus OX=10090 GN=Rasa1 PE=1 SV=1
11	Q91YX7	0.50	37.0	813	0.025	0.034	Q91YX7_MOUSE RAS p21 protein activator 1 OS=Mus musculus OX=10090 GN=Rasa1 PE=2 SV=1
12	E9PYG6	0.75	36.6	1038	0.025	0.027	E9PYG6_MOUSE RAS p21 protein activator 1 OS=Mus musculus OX=10090 GN=Rasa1 PE=1 SV=1
13	P50904	0.77	36.6	1038	0.025	0.027	RASA1_RAT Ras GTPase-activating protein 1 OS=Rattus norvegicus OX=10116 GN=Rasa1 PE=1 SV=1
14	P20936	1.5	35.4	1047	0.028	0.031	RASA1_HUMAN Ras GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RASA1 PE=1 SV=1
15	P0C896	4.5	33.9	576	0.030	0.059	PP209_ARATH Small ribosomal subunit protein mS80 (rPPR6) OS=Arabidopsis thaliana OX=3702 GN=At3g02650 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09469 Cobl	3.6e-45	163.6	Cordon-bleu ubiquitin-like domain
2	PF02196 RBD	0.13	23.6	Raf-like Ras-binding domain
3	PF11470 TUG-UBL1	3.3e+02	12.9	TUG ubiquitin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000341360

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263246	0.887	Protein kinase C and casein kinase substrate in neurons protein 2
2	9606.ENSP00000440945	0.884	Protein kinase C and casein kinase substrate in neurons protein 3
3	9606.ENSP00000484060	0.789	Protein kinase C and casein kinase substrate in neurons protein 1
4	9606.ENSP00000263915	0.735	Growth factor receptor-bound protein 14
5	9606.ENSP00000356297	0.709	Pleckstrin homology and RhoGEF domain containing G1
6	9606.ENSP00000324287	0.697	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2
7	9606.ENSP00000422473	0.685	Transmembrane protein 33
8	9606.ENSP00000361064	0.681	Multiple inositol polyphosphate phosphatase 1
9	9606.ENSP00000361423	0.622	Tyrosine-protein kinase ABL1
10	9606.ENSP00000355895	0.612	Lysophospholipase-like protein 1
11	9606.ENSP00000357409	0.612	DC-STAMP domain containing 2
12	9606.ENSP00000211314	0.606	Transmembrane protein 14A
13	9606.ENSP00000261486	0.551	Erythrocyte membrane protein band 4.1 like 4A
14	9606.ENSP00000299957	0.545	Protein CASC4
15	9606.ENSP00000332791	0.514	Kelch-like protein 15
16	9606.ENSP00000344446	0.510	FYVE, RhoGEF and PH domain-containing protein 6
17	9606.ENSP00000323183	0.507	Zinc finger and BTB domain-containing protein 2
18	9606.ENSP00000482502	0.506	S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0045296	1.000	cadherin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050794	0.929	regulation of cellular process
GO:0032502	0.802	developmental process
GO:0071840	0.777	cellular component organization or biogenesis
GO:0016043	0.767	cellular component organization
GO:0048518	0.643	positive regulation of biological process
GO:0006996	0.600	organelle organization
GO:0048522	0.520	positive regulation of cellular process
GO:0050896	0.516	response to stimulus
GO:0048856	0.418	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070062	0.996	extracellular exosome
GO:0005737	0.958	cytoplasm
GO:0043229	0.956	intracellular organelle
GO:0043231	0.941	intracellular membrane-bounded organelle
GO:0071944	0.748	cell periphery
GO:0016020	0.646	membrane
GO:0070013	0.570	intracellular organelle lumen
GO:0031981	0.563	nuclear lumen
GO:0005654	0.532	nucleoplasm
GO:0005829	0.467	cytosol
GO:0005886	0.426	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]