StarFunc result for job id Q53T94

User Input

>input (588 residues)
MDLEEAEEFKERCTQCAAVSWGLTDEGKYYCTSCHNVTERYQEVTNTDLIPNTQIKALNR
GLKKKNNTEKGWDWYVCEGFQYILYQQAEALKNLGVGPELKNDVLHNFWKRYLQKSKQAY
CKNPVYTTGRKPTVLEDNLSHSDWASEPELLSDVSCPPFLESGAESQSDIHTRKPFPVSK
ASQSETSVCSGSLDGVEYSQRKEKGIVKMTMPQTLAFCYLSLLWQREAITLSDLLRFVEE
DHIPYINAFQHFPEQMKLYGRDRGIFGIESWPDYEDIYKKTVEVGTFLDLPRFPDITEDC
YLHPNILCMKYLMEVNLPDEMHSLTCHVVKMTGMGEVDFLTFDPIAKMAKTVKYDVQAVA
IIVVVLKLLFLLDDSFEWSLSNLAEKHNEKNKKDKPWFDFRKWYQIMKKAFDEKKQKWEE
ARAKYLWKSEKPLYYSFVDKPVAYKKREMVVNLQKQFSTLVESTATAGKKSPSSFQFNWT
EEDTDRTCFHGHSLQGVLKEKGQSLLTKNSLYWLSTQKFCRCYCTHVTTYEESNYSLSYQ
FILNLFSFLLRIKTSLLHEEVSLVEKKLFEKKYSVKRKKSRSKKVRRH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q53T94	1.000	1.000	1.511E-90	588	1.000	1.000	Q53T94.pdb.gz	TAF1B_HUMAN TATA box-binding protein-associated factor RNA polymerase I subunit B OS=Homo sapiens OX=9606 GN=TAF1B PE=1 SV=1
2	AFDB:P97358	0.861	0.864	5.859E-73	586	0.743	0.746	P97358.pdb.gz	TAF1B_MOUSE TATA box-binding protein-associated factor RNA polymerase I subunit B OS=Mus musculus OX=10090 GN=Taf1b PE=1 SV=2
3	PDB:6rqhQ	0.305	0.394	8.614E-4	442	0.111	0.147	6rqhQ.pdb.gz	Molecular insight into RNA polymerase I promoter recognition and promoter melting.
4	PDB:5w65P	0.331	0.394	2.718E-3	481	0.119	0.146	5w65P.pdb.gz	Structural mechanism of ATP-independent transcription initiation by RNA polymerase I.
5	PDB:5n61Q	0.268	0.392	4.386E-3	389	0.095	0.144	5n61Q.pdb.gz	Structural Basis of RNA Polymerase I Transcription Initiation.
6	PDB:7zs9M	0.198	0.331	1.445E-1	310	0.066	0.126	7zs9M.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
7	PDB:5iy7M	0.169	0.288	2.962E-1	310	0.058	0.110	5iy7M.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
8	AFDB:A9ZLX4	0.118	0.078	4.366E-1	1072	0.071	0.039	A9ZLX4.pdb.gz	RIPR2_COTJA Rho family-interacting cell polarization regulator 2 OS=Coturnix japonica OX=93934 GN=RIPOR2 PE=1 SV=1
9	AFDB:Q9FMF5	0.082	0.069	5.818E-1	746	0.139	0.110	Q9FMF5.pdb.gz	RPT3_ARATH Root phototropism protein 3 OS=Arabidopsis thaliana OX=3702 GN=RPT3 PE=1 SV=2
10	AFDB:O04532	0.079	0.067	7.046E-1	760	0.107	0.083	O04532.pdb.gz	FH8_ARATH Formin-like protein 8 OS=Arabidopsis thaliana OX=3702 GN=FH8 PE=1 SV=1
11	AFDB:Q553Y8	0.080	0.060	7.754E-1	941	0.117	0.073	Q553Y8.pdb.gz	Q553Y8_DICDI Cell differentiation family, Rcd1-like protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0275289 PE=3 SV=1
12	PDB:1zp2A	0.084	0.194	8.492E-1	227	0.037	0.097	1zp2A.pdb.gz
13	PDB:7ml4M	0.185	0.403	1.028	234	0.054	0.137	7ml4M.pdb.gz	Structural visualization of de novo transcription initiation by Saccharomyces cerevisiae RNA polymerase II.
14	AFDB:Q9Y6H5	0.065	0.054	1.033	919	0.128	0.082	Q9Y6H5.pdb.gz	SNCAP_HUMAN Synphilin-1 OS=Homo sapiens OX=9606 GN=SNCAIP PE=1 SV=2
15	AFDB:P39936	0.077	0.067	1.084	914	0.122	0.079	P39936.pdb.gz	IF4F2_YEAST Eukaryotic initiation factor 4F subunit p130 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIF4632 PE=1 SV=1
16	PDB:7tnxA	0.076	0.072	1.187	647	0.082	0.074	7tnxA.pdb.gz	The RIG-I receptor adopts two different conformations for distinguishing host from viral RNA ligands.
17	AFDB:A0A024R3X5	0.075	0.065	1.313	710	0.075	0.062	A0A024R3X5.pdb.gz
18	AFDB:O74535	0.075	0.065	1.313	710	0.097	0.080	O74535.pdb.gz	CPSFX_SCHPO Cleavage and polyadenylation factor complex subunit C74.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC74.02c PE=1 SV=1
19	PDB:4pj3A	0.060	0.039	1.438	1335	0.048	0.021	4pj3A.pdb.gz	The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes.
20	PDB:5oa1U	0.161	0.300	1.508	291	0.039	0.079	5oa1U.pdb.gz	Structural insights into transcription initiation by yeast RNA polymerase I.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P97358	0.0	897	586	0.743	0.746	TAF1B_MOUSE TATA box-binding protein-associated factor RNA polymerase I subunit B OS=Mus musculus OX=10090 GN=Taf1b PE=1 SV=2
2	Q53T94	0.0	1227	588	1.000	1.000	TAF1B_HUMAN TATA box-binding protein-associated factor RNA polymerase I subunit B OS=Homo sapiens OX=9606 GN=TAF1B PE=1 SV=1
3	Q9VH20	3.12e-06	52.8	872	0.077	0.052	TAF1B_DROME TATA box-binding protein-associated factor RNA polymerase I subunit B OS=Drosophila melanogaster OX=7227 GN=TAF1B PE=1 SV=1
4	Q5XVF0	0.93	35.0	666	0.029	0.026	MEE12_ARATH TATA box-binding protein-associated factor RNA polymerase I subunit B OS=Arabidopsis thaliana OX=3702 GN=MEE12 PE=1 SV=1
5	Q9W157	2.3	33.9	971	0.080	0.048	BRCA2_DROME Breast cancer type 2 susceptibility protein homolog OS=Drosophila melanogaster OX=7227 GN=Brca2 PE=1 SV=3
6	A0A0G2K777	2.4	33.5	752	0.036	0.028	A0A0G2K777_RAT Ras homolog family member T1 OS=Rattus norvegicus OX=10116 GN=Rhot1 PE=1 SV=1
7	A0A8I6AGU0	2.6	33.5	672	0.036	0.031	A0A8I6AGU0_RAT Mitochondrial Rho GTPase OS=Rattus norvegicus OX=10116 GN=Rhot1 PE=3 SV=1
8	A0A8I6AMM4	2.6	33.5	612	0.036	0.034	A0A8I6AMM4_RAT Mitochondrial Rho GTPase OS=Rattus norvegicus OX=10116 GN=Rhot1 PE=1 SV=1
9	A0A8I6AVD9	2.6	33.5	704	0.036	0.030	A0A8I6AVD9_RAT Mitochondrial Rho GTPase OS=Rattus norvegicus OX=10116 GN=Rhot1 PE=1 SV=1
10	A0A0G2K8T2	2.8	33.5	663	0.036	0.032	A0A0G2K8T2_RAT Mitochondrial Rho GTPase OS=Rattus norvegicus OX=10116 GN=Rhot1 PE=1 SV=1
11	A1L1L6	2.9	33.1	631	0.036	0.033	A1L1L6_RAT Mitochondrial Rho GTPase OS=Rattus norvegicus OX=10116 GN=Rhot1 PE=2 SV=1
12	F7EK49	3.0	33.1	629	0.036	0.033	F7EK49_RAT Mitochondrial Rho GTPase OS=Rattus norvegicus OX=10116 GN=Rhot1 PE=1 SV=1
13	Q8IXI2	3.3	33.1	618	0.036	0.034	MIRO1_HUMAN Mitochondrial Rho GTPase 1 OS=Homo sapiens OX=9606 GN=RHOT1 PE=1 SV=2
14	B1N1A2	5.0	32.3	312	0.027	0.051	HSPA_PSEP6 6-hydroxy-3-succinoylpyridine 3-monooxygenase HspA OS=Pseudomonas putida (strain DSM 28022 / S16) OX=1042876 GN=hspA PE=1 SV=1
15	Q8BG51	5.7	32.3	631	0.036	0.033	MIRO1_MOUSE Mitochondrial Rho GTPase 1 OS=Mus musculus OX=10090 GN=Rhot1 PE=1 SV=1
16	Q6NYV1	6.3	32.3	503	0.031	0.036	Q6NYV1_DANRE 26S proteasome non-ATPase regulatory subunit 3 OS=Danio rerio OX=7955 GN=zgc:65867 PE=1 SV=1
17	Q9UST5	8.5	31.6	537	0.061	0.067	RRN7_SCHPO RNA polymerase I-specific transcription initiation factor rrn7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rrn7 PE=1 SV=1
18	F2XFA8	8.7	32.0	627	0.043	0.040	PINS1_PICSI (-)-alpha-pinene synthase 1, chloroplastic OS=Picea sitchensis OX=3332 GN=TPS-Pin PE=1 SV=1
19	O74731	9.2	31.6	479	0.044	0.054	DUS2_SCHPO tRNA-dihydrouridine(20) synthase [NAD(P)+] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dus2 PE=1 SV=1
20	O74378	9.4	31.6	1009	0.027	0.016	ODO1_SCHPO 2-oxoglutarate dehydrogenase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=kgd1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18494 Pullulanase_Ins	4.3e+02	12.8	Pullulanase Ins domain
2	PF11781 zf-RRN7	3.2e-07	41.2	Zinc-finger of RNA-polymerase I-specific TFIIB, Rrn7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263663

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339976	0.999	TATA box-binding protein-associated factor RNA polymerase I subunit A
2	9606.ENSP00000455265	0.998	TATA box-binding protein-associated factor RNA polymerase I subunit C
3	9606.ENSP00000410409	0.994	TATA box-binding protein-associated factor RNA polymerase I subunit D
4	9606.ENSP00000375942	0.979	TATA-box-binding protein
5	9606.ENSP00000332194	0.949	Histone H2A type 2-C
6	9606.ENSP00000198767	0.946	RNA polymerase I-specific transcription initiation factor RRN3
7	9606.ENSP00000358151	0.946	Histone H2B type 2-E
8	9606.ENSP00000362649	0.927	Histone deacetylase 1
9	9606.ENSP00000212015	0.909	NAD-dependent protein deacetylase sirtuin-1
10	9606.ENSP00000296417	0.909	Histone H2A.Z
11	9606.ENSP00000278823	0.904	Metastasis-associated protein MTA2
12	9606.ENSP00000430432	0.903	Histone deacetylase 2
13	9606.ENSP00000477907	0.903	Histone H2B type 1-M
14	9606.ENSP00000477527	0.902	Histone H2B type 1-O
15	9606.ENSP00000482674	0.902	Histone H2B type 1-B
16	9606.ENSP00000483903	0.902	Histone H2B type 1-N
17	9606.ENSP00000333633	0.901	Metastasis-associated protein MTA1
18	9606.ENSP00000367022	0.901	Histone H2A type 1-C
19	9606.ENSP00000383973	0.901	Metastasis-associated protein MTA3
20	9606.ENSP00000274764	0.900	Histone H2B type 1-A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.995	heterocyclic compound binding
GO:0097159	0.995	organic cyclic compound binding
GO:0003676	0.994	nucleic acid binding
GO:0003677	0.979	DNA binding
GO:0043565	0.971	sequence-specific DNA binding
GO:0000976	0.960	transcription cis-regulatory region binding
GO:0008134	0.959	transcription factor binding
GO:0001046	0.923	core promoter sequence-specific DNA binding
GO:0017025	0.916	TBP-class protein binding
GO:0001164	0.832	RNA polymerase I core promoter sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.993	primary metabolic process
GO:0006807	0.989	nitrogen compound metabolic process
GO:0043170	0.984	macromolecule metabolic process
GO:0044237	0.982	cellular metabolic process
GO:0071840	0.965	cellular component organization or biogenesis
GO:0016043	0.964	cellular component organization
GO:0010467	0.896	gene expression
GO:0009059	0.895	macromolecule biosynthetic process
GO:0016070	0.895	RNA metabolic process
GO:0034654	0.895	nucleobase-containing compound biosynthetic process
GO:0006351	0.892	DNA-templated transcription
GO:0071824	0.858	protein-DNA complex subunit organization
GO:0022607	0.761	cellular component assembly
GO:0006360	0.740	transcription by RNA polymerase I
GO:0065004	0.574	protein-DNA complex assembly
GO:0006352	0.438	DNA-templated transcription initiation
GO:0070897	0.301	transcription preinitiation complex assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0000120	1.000	RNA polymerase I transcription regulator complex
GO:0005737	0.321	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]