StarFunc result for job id Q53TQ3

User Input

>input (1027 residues)
MYEGKHIHFSEVDNKPLCSYSPKLCKQRRLNGYAFCIRHVLEDKTAPFKQCEYVAKYNSQ
RCTNPIPKSEDRRYCNSHLQVLGFIPKKERKKKNDPIDEVKVRHQMDTMAFSLTVPTLAL
KMPNGLDGMSLSPPGARVPLHYLETELEDPFAFNEEDDDLKKGATVRKKLQSKLAQNRQR
QRETEILKVRQEHFSPPPAPSQQQPPQQHSHLSPLSTSLKPPAPPQGSVCKSPQPQNTSL
PMQGVAPTTHTIAQARQLSHKRPLPLLPSSRAPTVDPPRTDRILMKATAFSPHFSCISRL
QRLVKLCTQKHQLDTDLFPHLGLDWSEESGEEPEDSEQASPYQVAWSIRETLRYQRHASD
DDDAESRSSRVTQLCTYFQQKYKHLCRLERAESRQKKCRHTFRKALLQAASKEPECTGQL
IQELRRAACSRTSISRTKLREVEPAACSGTVKGEQCANKALPFTRHCFQHILLNHSQQLF
SSCTAKFADGQQCSVPVFDITHQTPLCEEHAKKMDNFLRGDNSRKVQHQQQRKPRKKTKP
PALTKKHKKKRRRGPRRPQKPIPPAVPQGNLSMPASVSLPVEASHIRSPSTPELSADELP
DDIANEITDIPHDLELNQEDFSDVLPRLPDDLQDFDFFEGKNGDLLPTTEEAEELERALQ
AVTSLECLSTIGVLAQSDGVPVQELSDRGIGVFSTGTGASGIQSLSREVNTDLGELLNGR
IVHDNFSSLELDENLLRSATLSNPPTPLAGQIQGQFSAPANVGLTSATLISQSALGERAF
PGQFHGLHDGSHASQRPHPAQLLSKADDLITSRQQYSSDHSHSSPHGSHYDSEHVPSPYS
DHITSPHTTSYSGDNMAATFSAEMPIMAQHLLPTQLEVPLGGVVNPRTHWGNLPVNLGDP
SPFSNLLGADGHLLSTSLSTPPTTSNSETTQPAFATVTPSSSSVLPGLPQTSFSGMGPSA
ELMASTSPKQQLPQFSAAFGHQLSSHSGIPKDLQPSHSSIAPPTGFTVTGATATSTNNAS
SPFPSPN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q53TQ3	1.000	1.000	0.000	1027	1.000	1.000	Q53TQ3.pdb.gz	IN80D_HUMAN INO80 complex subunit D OS=Homo sapiens OX=9606 GN=INO80D PE=1 SV=3
2	AFDB:Q9HGL2	0.052	0.048	2.957E-6	1116	0.130	0.120	Q9HGL2.pdb.gz	YHLA_SCHPO Uncharacterized calcium-binding protein C800.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC800.10c PE=4 SV=1
3	AFDB:P35658	0.054	0.034	3.351E-6	2090	0.152	0.075	P35658.pdb.gz	NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2
4	AFDB:Q10328	0.052	0.056	4.303E-6	942	0.129	0.140	Q10328.pdb.gz	PHX1_SCHPO Homeobox transcription factor phx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=phx1 PE=3 SV=1
5	AFDB:Q14678	0.049	0.039	5.525E-6	1352	0.144	0.109	Q14678.pdb.gz	KANK1_HUMAN KN motif and ankyrin repeat domain-containing protein 1 OS=Homo sapiens OX=9606 GN=KANK1 PE=1 SV=3
6	AFDB:Q9NSY1	0.055	0.050	6.665E-6	1161	0.113	0.100	Q9NSY1.pdb.gz	BMP2K_HUMAN BMP-2-inducible protein kinase OS=Homo sapiens OX=9606 GN=BMP2K PE=1 SV=2
7	AFDB:P34244	0.053	0.041	8.558E-6	1518	0.138	0.094	P34244.pdb.gz	HSL1_YEAST Probable serine/threonine-protein kinase HSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HSL1 PE=1 SV=2
8	AFDB:Q9FXI5	0.049	0.061	9.110E-6	794	0.121	0.156	Q9FXI5.pdb.gz	IQD32_ARATH Protein IQ-DOMAIN 32 OS=Arabidopsis thaliana OX=3702 GN=IQD32 PE=1 SV=3
9	AFDB:Q9ULK2	0.058	0.067	9.698E-6	861	0.124	0.148	Q9ULK2.pdb.gz	AT7L1_HUMAN Ataxin-7-like protein 1 OS=Homo sapiens OX=9606 GN=ATXN7L1 PE=1 SV=3
10	AFDB:Q6ZU35	0.062	0.054	1.702E-5	1233	0.145	0.121	Q6ZU35.pdb.gz	CRACD_HUMAN Capping protein-inhibiting regulator of actin dynamics OS=Homo sapiens OX=9606 GN=CRACD PE=1 SV=3
11	PDB:5n9jB	0.056	0.296	2.854	133	0.021	0.165	5n9jB.pdb.gz
12	PDB:6lthQ	0.043	0.298	2.854	105	0.024	0.238	6lthQ.pdb.gz	Structure of nucleosome-bound human BAF complex.
13	PDB:7c4jH	0.044	0.153	2.854	242	0.021	0.091	7c4jH.pdb.gz
14	PDB:7v2wJ	0.046	0.139	4.154	236	0.019	0.085	7v2wJ.pdb.gz
15	PDB:6j6gA	0.047	0.028	5.334	1913	0.022	0.012	6j6gA.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
16	PDB:5svaU	0.044	0.186	5.678	156	0.021	0.141	5svaU.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
17	PDB:4gwqB	0.051	0.091	7.291	492	0.019	0.041	4gwqB.pdb.gz	Structure of the Mediator Head module bound to the carboxy-terminal domain of RNA polymerase II.
18	PDB:1i3qI	0.023	0.140	7.761	122	0.008	0.066	1i3qI.pdb.gz	Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
19	PDB:7abzX	0.031	0.230	8.261	77	0.004	0.052	7abzX.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.
20	PDB:6mdmH	0.041	0.244	9.362	147	0.020	0.143	6mdmH.pdb.gz	Structural principles of SNARE complex recognition by the AAA+ protein NSF.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q53TQ3	0.0	2110	1027	1.000	1.000	IN80D_HUMAN INO80 complex subunit D OS=Homo sapiens OX=9606 GN=INO80D PE=1 SV=3
2	Q66JY2	0.0	1852	1021	0.941	0.946	IN80D_MOUSE INO80 complex subunit D OS=Mus musculus OX=10090 GN=Ino80d PE=2 SV=4
3	Q8BQR4	5.62e-12	71.6	486	0.033	0.070	KANL2_MOUSE KAT8 regulatory NSL complex subunit 2 OS=Mus musculus OX=10090 GN=Kansl2 PE=1 SV=1
4	Q9H9L4	7.69e-12	71.2	492	0.033	0.069	KANL2_HUMAN KAT8 regulatory NSL complex subunit 2 OS=Homo sapiens OX=9606 GN=KANSL2 PE=1 SV=3
5	F8VXI8	8.27e-12	71.2	454	0.033	0.075	F8VXI8_HUMAN KAT8 regulatory NSL complex subunit 2 OS=Homo sapiens OX=9606 GN=KANSL2 PE=1 SV=1
6	F8VX10	1.31e-11	71.2	675	0.033	0.050	F8VX10_HUMAN KAT8 regulatory NSL complex subunit 2 OS=Homo sapiens OX=9606 GN=KANSL2 PE=1 SV=1
7	Q9VFH4	3.53e-08	60.5	1200	0.057	0.049	Q9VFH4_DROME LD12755p OS=Drosophila melanogaster OX=7227 GN=l(3)L1231 PE=2 SV=1
8	A0A0B4LHU7	4.08e-05	50.1	589	0.022	0.039	A0A0B4LHU7_DROME KAT8 regulatory NSL complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=dgt1 PE=1 SV=1
9	Q9VAF4	9.91e-05	48.5	484	0.022	0.048	Q9VAF4_DROME KAT8 regulatory NSL complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=dgt1 PE=1 SV=2
10	A0A0B4KHH6	1.06e-04	48.5	425	0.022	0.054	A0A0B4KHH6_DROME KAT8 regulatory NSL complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=dgt1 PE=1 SV=1
11	H0YHR2	0.006	41.6	206	0.021	0.107	H0YHR2_HUMAN KAT8 regulatory NSL complex subunit 2 (Fragment) OS=Homo sapiens OX=9606 GN=KANSL2 PE=1 SV=1
12	A0A384KCR8	0.031	40.0	280	0.021	0.079	A0A384KCR8_ARATH KAT8 regulatory NSL complex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=At1g05860 PE=1 SV=1
13	P46582	0.091	39.3	1024	0.014	0.014	SUMV1_CAEEL Protein sumv-1 OS=Caenorhabditis elegans OX=6239 GN=sumv-1 PE=2 SV=2
14	O94900	5.5	33.1	526	0.025	0.049	TOX_HUMAN Thymocyte selection-associated high mobility group box protein TOX OS=Homo sapiens OX=9606 GN=TOX PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13891 zf-C3Hc3H	6.2e-28	108.2	Potential DNA-binding domain
2	PF09329 zf-primase	0.11	23.7	Primase zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384198

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000457016	0.985	INO80 complex subunit E
2	9606.ENSP00000318297	0.949	RuvB-like 1
3	9606.ENSP00000436926	0.935	Nuclear factor related to kappa-B-binding protein
4	9606.ENSP00000355205	0.934	DNA helicase INO80
5	9606.ENSP00000243903	0.932	Actin-related protein 5
6	9606.ENSP00000356425	0.927	Ubiquitin carboxyl-terminal hydrolase isozyme L5
7	9606.ENSP00000349640	0.924	Microspherule protein 1
8	9606.ENSP00000262238	0.921	Transcriptional repressor protein YY1
9	9606.ENSP00000233331	0.916	INO80 complex subunit B
10	9606.ENSP00000285021	0.902	DNA repair protein complementing XP-C cells
11	9606.ENSP00000384109	0.902	Cullin-4B
12	9606.ENSP00000304102	0.901	COP9 signalosome complex subunit 6
13	9606.ENSP00000350512	0.901	COP9 signalosome complex subunit 5
14	9606.ENSP00000216225	0.900	E3 ubiquitin-protein ligase RBX1
15	9606.ENSP00000256996	0.900	DNA damage-binding protein 2
16	9606.ENSP00000264389	0.900	COP9 signalosome complex subunit 4
17	9606.ENSP00000268717	0.900	COP9 signalosome complex subunit 3
18	9606.ENSP00000299259	0.900	COP9 signalosome complex subunit 2
19	9606.ENSP00000301764	0.900	DNA damage-binding protein 1
20	9606.ENSP00000346340	0.900	COP9 signalosome complex subunit 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.454	heterocyclic compound binding
GO:0097159	0.436	organic cyclic compound binding
GO:0003676	0.425	nucleic acid binding
GO:0003824	0.398	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0009987	0.991	cellular process
GO:0033044	0.981	regulation of chromosome organization
GO:0071704	0.977	organic substance metabolic process
GO:0044238	0.975	primary metabolic process
GO:0006807	0.970	nitrogen compound metabolic process
GO:0051726	0.964	regulation of cell cycle
GO:0043170	0.959	macromolecule metabolic process
GO:0051052	0.934	regulation of DNA metabolic process
GO:0016043	0.925	cellular component organization
GO:0006325	0.922	chromatin organization
GO:0010468	0.906	regulation of gene expression
GO:0006355	0.897	regulation of DNA-templated transcription
GO:0010604	0.895	positive regulation of macromolecule metabolic process
GO:0045893	0.885	positive regulation of DNA-templated transcription
GO:0044237	0.860	cellular metabolic process
GO:0006275	0.827	regulation of DNA replication
GO:0006338	0.786	chromatin remodeling
GO:0006725	0.635	cellular aromatic compound metabolic process
GO:0034641	0.634	cellular nitrogen compound metabolic process
GO:1901360	0.630	organic cyclic compound metabolic process
GO:0006139	0.623	nucleobase-containing compound metabolic process
GO:0044260	0.584	cellular macromolecule metabolic process
GO:0090304	0.577	nucleic acid metabolic process
GO:1901564	0.422	organonitrogen compound metabolic process
GO:0019538	0.390	protein metabolic process
GO:0006259	0.347	DNA metabolic process
GO:0043412	0.325	macromolecule modification
GO:0050896	0.323	response to stimulus
GO:0036211	0.313	protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0031011	0.998	Ino80 complex
GO:0005737	0.928	cytoplasm
GO:0005829	0.924	cytosol
GO:0016020	0.382	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]