StarFunc result for job id Q562E7

User Input

>input (1941 residues)
MAQGSGGREGALRTPAGGWHSPPSPDMQELLRSVERDLSIDPRQLAPAPGGTHVVALVPA
RWLASLRDRRLPLGPCPRAEGLGEAEVRTLLQRSVQRLPAGWTRVEVHGLRKRRLSYPLG
GGLPFEDGSCGPETLTRFMQEVAAQNYRNLWRHAYHTYGQPYSHSPAPSAVPALDSVRQA
LQRVYGCSFLPVGETTQCPSYAREGPCPPRGSPACPSLLRAEALLESPEMLYVVHPYVQF
SLHDVVTFSPAKLTNSQAKVLFILFRVLRAMDACHRQGLACGALSLYHIAVDEKLCSELR
LDLSAYERPEEDENEEAPVARDEAGIVSQEEQGGQPGQPTGQEELRSLVLDWVHGRISNF
HYLMQLNRLAGRRQGDPNYHPVLPWVVDFTTPHGRFRDLRKSKFRLNKGDKQLDFTYEMT
RQAFVAGGAGGGEPPHVPHHISDVLSDITYYVYKARRTPRSVLCGHVRAQWEPHEYPASM
ERMQNWTPDECIPEFYTDPSIFRSIHPDMPDLDVPAWCSSSQEFVAAHRALLESREVSRD
LHHWIDLTFGYKLQGKEAVKEKNVCLHLVDAHTHLASYGVVQLFDQPHPQRLAGAPALAP
EPPLIPKLLVQTIQETTGREDFTENPGQLPNGVGRPVLEATPCEASWTRDRPVAGEDDLE
QATEALDSISLAGKAGDQLGSSSQASPGLLSFSVASASRPGRRNKAAGADPGEGEEGRIL
LPEGFNPMQALEELEKTGNFLAKGLGGLLEVPEQPRVQPAVPLQCLLHRDMQALGVLLAE
MVFATRVRTLQPDAPLWVRFQAVRGLCTRHPKEVPVSLQPVLDTLLQMSGPEVPMGAERG
KLDQLFEYRPVSQGLPPPCPSQLLSPFSSVVPFPPYFPALHRFILLYQARRVEDEAQGRE
LVFALWQQLGAVLKDITPEGLEILLPFVLSLMSEEHTAVYTAWYLFEPVAKALGPKNANK
YLLKPLIGAYESPCQLHGRFYLYTDCFVAQLMVRLGLQAFLTHLLPHVLQVLAGAEASQE
ESKDLAGAAEEEESGLPGAGPGSCAFGEEIPMDGEPPASSGLGLPDYTSGVSFHDQADLP
ETEDFQAGLYVTESPQPQEAEAVSLGRLSDKSSTSETSLGEERAPDEGGAPVDKSSLRSG
DSSQDLKQSEGSEEEEEEEDSCVVLEEEEGEQEEVTGASELTLSDTVLSMETVVAGGSGG
DGEEEEEALPEQSEGKEQKILLDTACKMVRWLSAKLGPTVASRHVARNLLRLLTSCYVGP
TRQQFTVSSGESPPLSAGNIYQKRPVLGDIVSGPVLSCLLHIARLYGEPVLTYQYLPYIS
YLVAPGSASGPSRLNSRKEAGLLAAVTLTQKIIVYLSDTTLMDILPRISHEVLLPVLSFL
TSLVTGFPSGAQARTILCVKTISLIALICLRIGQEMVQQHLSEPVATFFQVFSQLHELRQ
QDLKLDPAGRGEGQLPQVVFSDGQQRPVDPALLDELQKVFTLEMAYTIYVPFSCLLGDII
RKIIPNHELVGELAALYLESISPSSRNPASVEPTMPGTGPEWDPHGGGCPQDDGHSGTFG
SVLVGNRIQIPNDSRPENPGPLGPISGVGGGGLGSGSDDNALKQELPRSVHGLSGNWLAY
WQYEIGVSQQDAHFHFHQIRLQSFPGHSGAVKCVAPLSSEDFFLSGSKDRTVRLWPLYNY
GDGTSETAPRLVYTQHRKSVFFVGQLEAPQHVVSCDGAVHVWDPFTGKTLRTVEPLDSRV
PLTAVAVMPAPHTSITMASSDSTLRFVDCRKPGLQHEFRLGGGLNPGLVRALAISPSGRS
VVAGFSSGFMVLLDTRTGLVLRGWPAHEGDILQIKAVEGSVLVSSSSDHSLTVWKELEQK
PTHHYKSASDPIHTFDLYGSEVVTGTVSNKIGVCSLLEPPSQATTKLSSENFRGTLTSLA
LLPTKRHLLLGSDNGVIRLLA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q562E7	1.000	1.000	0.000	1941	1.000	1.000	Q562E7.pdb.gz	WDR81_HUMAN WD repeat-containing protein 81 OS=Homo sapiens OX=9606 GN=WDR81 PE=1 SV=2
2	AFDB:Q5ND34	0.844	0.846	0.000	1934	0.875	0.878	Q5ND34.pdb.gz	WDR81_MOUSE WD repeat-containing protein 81 OS=Mus musculus OX=10090 GN=Wdr81 PE=1 SV=2
3	AFDB:F4JY12	0.375	0.438	8.150E-54	1639	0.208	0.246	F4JY12.pdb.gz	GFS12_ARATH Protein GFS12 OS=Arabidopsis thaliana OX=3702 GN=GFS12 PE=1 SV=1
4	PDB:3dm0A	0.141	0.386	1.094E-13	675	0.035	0.099	3dm0A.pdb.gz	Structure of a signal transduction regulator, RACK1, from Arabidopsis thaliana.
5	PDB:5mzhB	0.138	0.574	1.283E-13	415	0.032	0.149	5mzhB.pdb.gz
6	PDB:7pzyh	0.144	0.830	2.155E-13	311	0.032	0.199	7pzyh.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
7	PDB:2h9lA	0.139	0.761	4.598E-13	321	0.031	0.187	2h9lA.pdb.gz
8	PDB:5mqfF	0.134	0.776	1.062E-12	307	0.029	0.186	5mqfF.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
9	PDB:5nnzA	0.136	0.704	1.405E-12	335	0.028	0.164	5nnzA.pdb.gz
10	PDB:7vggA	0.142	0.840	1.715E-12	304	0.021	0.135	7vggA.pdb.gz
11	PDB:7qdrC	0.141	0.839	1.932E-12	305	0.024	0.151	7qdrC.pdb.gz
12	PDB:6u62A	0.137	0.235	2.359E-12	1110	0.043	0.076	6u62A.pdb.gz	Structural basis for the docking of mTORC1 on the lysosomal surface.
13	PDB:4v6wAg	0.141	0.803	3.245E-12	318	0.029	0.179	4v6wAg.pdb.gz	Structures of the human and Drosophila 80S ribosome.
14	AFDB:P16371	0.141	0.359	1.963E-11	730	0.060	0.159	P16371.pdb.gz	GROU_DROME Protein groucho OS=Drosophila melanogaster OX=7227 GN=gro PE=1 SV=3
15	AFDB:Q5XPS1	0.140	0.250	3.430E-11	1057	0.080	0.148	Q5XPS1.pdb.gz	Q5XPS1_CHLRE Axonemal inner arm I1 intermediate chain dynein IC138 OS=Chlamydomonas reinhardtii OX=3055 GN=BOP5 PE=1 SV=1
16	AFDB:Q6NLV4	0.150	0.421	1.906E-10	647	0.032	0.096	Q6NLV4.pdb.gz	FY_ARATH Flowering time control protein FY OS=Arabidopsis thaliana OX=3702 GN=FY PE=1 SV=1
17	AFDB:Q389F7	0.134	0.229	6.631E-9	1105	0.029	0.051	Q389F7.pdb.gz	Q389F7_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0030 PE=4 SV=1
18	AFDB:Q6S003	0.141	0.146	1.359E-8	1873	0.107	0.111	Q6S003.pdb.gz	KIF8_DICDI Kinesin-related protein 8 OS=Dictyostelium discoideum OX=44689 GN=kif8 PE=2 SV=1
19	AFDB:O43379	0.136	0.172	7.257E-8	1518	0.027	0.034	O43379.pdb.gz	WDR62_HUMAN WD repeat-containing protein 62 OS=Homo sapiens OX=9606 GN=WDR62 PE=1 SV=4
20	AFDB:Q9VC96	0.136	0.119	1.745E-7	2232	0.027	0.023	Q9VC96.pdb.gz	Q9VC96_DROME BRWD3 OS=Drosophila melanogaster OX=7227 GN=BRWD3 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q562E7	0.0	3945	1941	1.000	1.000	WDR81_HUMAN WD repeat-containing protein 81 OS=Homo sapiens OX=9606 GN=WDR81 PE=1 SV=2
2	Q5ND34	0.0	3342	1934	0.874	0.877	WDR81_MOUSE WD repeat-containing protein 81 OS=Mus musculus OX=10090 GN=Wdr81 PE=1 SV=2
3	F4JY12	8.66e-70	263	1639	0.080	0.095	GFS12_ARATH Protein GFS12 OS=Arabidopsis thaliana OX=3702 GN=GFS12 PE=1 SV=1
4	Q10122	4.61e-62	237	1382	0.059	0.082	SORF2_CAEEL Suppressor of organelle fusion 2 OS=Caenorhabditis elegans OX=6239 GN=sorf-2 PE=1 SV=4
5	Q6ZNJ1	2.78e-23	111	2754	0.051	0.036	NBEL2_HUMAN Neurobeachin-like protein 2 OS=Homo sapiens OX=9606 GN=NBEAL2 PE=1 SV=2
6	Q9ESE1	3.29e-23	111	2856	0.048	0.033	LRBA_MOUSE Lipopolysaccharide-responsive and beige-like anchor protein OS=Mus musculus OX=10090 GN=Lrba PE=1 SV=1
7	E7EZD1	3.74e-23	110	2998	0.052	0.033	E7EZD1_DANRE Neurobeachin OS=Danio rerio OX=7955 GN=im:7138260 PE=1 SV=2
8	P50851	5.27e-23	110	2863	0.048	0.032	LRBA_HUMAN Lipopolysaccharide-responsive and beige-like anchor protein OS=Homo sapiens OX=9606 GN=LRBA PE=1 SV=4
9	O35242	9.83e-23	108	920	0.053	0.111	FAN_MOUSE Protein FAN OS=Mus musculus OX=10090 GN=Nsmaf PE=1 SV=2
10	A0A8I6A334	1.59e-22	107	830	0.045	0.105	A0A8I6A334_RAT Neutral sphingomyelinase activation associated factor OS=Rattus norvegicus OX=10116 GN=Nsmaf PE=1 SV=1
11	A0A8I6API9	2.01e-22	107	912	0.045	0.095	A0A8I6API9_RAT Neutral sphingomyelinase activation associated factor OS=Rattus norvegicus OX=10116 GN=Nsmaf PE=1 SV=1
12	F1M974	2.53e-22	107	920	0.045	0.095	F1M974_RAT Neutral sphingomyelinase activation associated factor OS=Rattus norvegicus OX=10116 GN=Nsmaf PE=1 SV=3
13	A0A0G2K4H2	3.18e-22	107	885	0.045	0.098	A0A0G2K4H2_RAT Neutral sphingomyelinase activation associated factor OS=Rattus norvegicus OX=10116 GN=Nsmaf PE=1 SV=2
14	Q6ZQA0	5.36e-22	107	2742	0.050	0.035	NBEL2_MOUSE Neurobeachin-like protein 2 OS=Mus musculus OX=10090 GN=Nbeal2 PE=1 SV=2
15	Q7TSY5	5.83e-22	106	920	0.044	0.093	Q7TSY5_RAT Neutral sphingomyelinase activation associated factor OS=Rattus norvegicus OX=10116 GN=Nsmaf PE=2 SV=1
16	Q9EPN1	1.31e-21	105	2936	0.052	0.034	NBEA_MOUSE Neurobeachin OS=Mus musculus OX=10090 GN=Nbea PE=1 SV=1
17	Q6VNB8	1.59e-21	105	3508	0.050	0.028	WDFY3_MOUSE WD repeat and FYVE domain-containing protein 3 OS=Mus musculus OX=10090 GN=Wdfy3 PE=1 SV=1
18	Q8IZQ1	1.60e-21	105	3526	0.050	0.028	WDFY3_HUMAN WD repeat and FYVE domain-containing protein 3 OS=Homo sapiens OX=9606 GN=WDFY3 PE=1 SV=2
19	E7FAW3	4.05e-21	104	2801	0.048	0.034	NBEL2_DANRE Neurobeachin-like protein 2 OS=Danio rerio OX=7955 GN=nbeal2 PE=1 SV=1
20	Q92636	5.17e-21	103	917	0.055	0.116	FAN_HUMAN Protein FAN OS=Homo sapiens OX=9606 GN=NSMAF PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02138 Beach	2.6e-37	140.3	Beige/BEACH domain
2	PF20426 NBCH_WD40	3.7e+02	11.3	Neurobeachin beta propeller domain
3	PF13360 PQQ_2	4.4e+02	11.9	PQQ-like domain
4	PF00400 WD40	1e-08	46.9	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386609

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000346466	0.969	WD repeat-containing protein 91
2	9606.ENSP00000314407	0.911	Carbonic anhydrase-related protein
3	9606.ENSP00000355231	0.881	Beclin-1
4	9606.ENSP00000349785	0.792	Microtubule-associated proteins 1A/1B light chain 3C
5	9606.ENSP00000371532	0.772	Very low-density lipoprotein receptor
6	9606.ENSP00000330631	0.755	Reticulon-4 receptor-like 1
7	9606.ENSP00000304360	0.754	SET and MYND domain containing 4
8	9606.ENSP00000331965	0.713	Regulates the composition and fluidity of the plasma membrane . Inhibits the incorporation of membrane-fluidizing phospholipids containing omega-3 long-chain polyunsaturated fatty acids (LCPUFA) and thereby promotes membrane rigidity . Does not appear to have any effect on LCPUFA synthesis .
9	9606.ENSP00000220509	0.709	Vacuolar protein sorting-associated protein 18 homolog
10	9606.ENSP00000405708	0.673	Coiled-coil domain-containing protein 39
11	9606.ENSP00000370208	0.650	RAB guanine nucleotide exchange factor 1
12	9606.ENSP00000230124	0.637	Polyphosphoinositide phosphatase
13	9606.ENSP00000256190	0.622	Myotubularin-related protein 13
14	9606.ENSP00000348455	0.620	UV radiation resistance-associated gene protein
15	9606.ENSP00000362550	0.617	Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1
16	9606.ENSP00000371070	0.616	Phospholipid-transporting ATPase IB
17	9606.ENSP00000370196	0.614	Myotubularin-related protein 5
18	9606.ENSP00000300935	0.597	Ras-related protein Rab-8A
19	9606.ENSP00000296473	0.569	Vacuolar fusion protein MON1 homolog A
20	9606.ENSP00000373272	0.567	E3 ubiquitin-protein ligase TRIM71

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0035014	1.000	phosphatidylinositol 3-kinase regulator activity
GO:0070530	1.000	K63-linked polyubiquitin modification-dependent protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.982	regulation of cellular process
GO:0006810	0.967	transport
GO:0044237	0.952	cellular metabolic process
GO:0071704	0.950	organic substance metabolic process
GO:0046907	0.948	intracellular transport
GO:0044238	0.940	primary metabolic process
GO:0031323	0.929	regulation of cellular metabolic process
GO:0006807	0.923	nitrogen compound metabolic process
GO:0009056	0.915	catabolic process
GO:0043170	0.913	macromolecule metabolic process
GO:0061919	0.912	process utilizing autophagic mechanism
GO:0044248	0.856	cellular catabolic process
GO:0050790	0.839	regulation of catalytic activity
GO:0065008	0.803	regulation of biological quality
GO:0043550	0.796	regulation of lipid kinase activity
GO:0016482	0.791	cytosolic transport
GO:0016236	0.785	macroautophagy
GO:1901564	0.782	organonitrogen compound metabolic process
GO:0019538	0.766	protein metabolic process
GO:0031647	0.759	regulation of protein stability
GO:0016192	0.732	vesicle-mediated transport
GO:0044260	0.657	cellular macromolecule metabolic process
GO:0009057	0.629	macromolecule catabolic process
GO:0006508	0.610	proteolysis
GO:0044265	0.595	cellular macromolecule catabolic process
GO:0071840	0.563	cellular component organization or biogenesis
GO:0016043	0.517	cellular component organization
GO:0043632	0.500	modification-dependent macromolecule catabolic process
GO:0043551	0.403	regulation of phosphatidylinositol 3-kinase activity
GO:0061912	0.381	selective autophagy
GO:0030163	0.328	protein catabolic process
GO:0006996	0.325	organelle organization
GO:0050821	0.319	protein stabilization
GO:0006511	0.315	ubiquitin-dependent protein catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0016020	0.996	membrane
GO:0012505	0.994	endomembrane system
GO:0010008	0.975	endosome membrane
GO:0005773	0.970	vacuole
GO:0000323	0.960	lytic vacuole
GO:0005829	0.957	cytosol
GO:0005769	0.957	early endosome
GO:0005770	0.913	late endosome
GO:0005764	0.883	lysosome
GO:0031901	0.705	early endosome membrane
GO:0019898	0.702	extrinsic component of membrane
GO:0005774	0.660	vacuolar membrane
GO:0005776	0.618	autophagosome
GO:0098852	0.605	lytic vacuole membrane
GO:0031902	0.592	late endosome membrane
GO:0005765	0.585	lysosomal membrane
GO:0031312	0.464	extrinsic component of organelle membrane
GO:0000421	0.377	autophagosome membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]