StarFunc result for job id Q562F6

User Input

>input (1265 residues)
MECPVMETGSLFTSGIKRHLKDKRISKTTKLNVSLASKIKTKILNNSSIFKISLKHNNRA
LAQALSREKENSRRITTEKMLLQKEVEKLNFENTFLRLKLNNLNKKLIDIEALMNNNLIT
AIEMSSLSEFHQSSFLLSASKKKRISKQCKLMRLPFARVPLTSNDDEDEDKEKMQCDNNI
KSKTLPDIPSSGSTTQPLSTQDNSEVLFLKENNQNVYGLDDSEHISSIVDVPPRESHSHS
DQSSKTSLMSEMRNAQSIGRRWEKPSPSNVTERKKRGSSWESNNLSADTPCATVLDKQHI
SSPELNCNNEINGHTNETNTEMQRNKQDLPGLSSESAREPNAECMNQIEDNDDFQLQKTV
YDADMDLTASEVSKIVTVSTGIKKKSNKKTNEHGMKTFRKVKDSSSEKKRERSKRQFKNS
SDVDIGEKIENRTERSDVLDGKRGAEDPGFIFNNEQLAQMNEQLAQVNELKKMTLQTGFE
QGDRENVLCNKKEKRITNEQEETYSLSQSSGKFHQESKFDKGQNSLTCNKSKASRQTFVI
HKLEKDNLLPNQKDKVTIYENLDVTNEFHTANLSTKDNGNLCDYGTHNILDLKKYVTDIQ
PSEQNESNINKLRKKVNRKTEIISGMNHMYEDNDKDVVHGLKKGNFFFKTQEDKEPISEN
IEVSKELQIPALSTRDNENQCDYRTQNVLGLQKQITNMYPVQQNESKVNKKLRQKVNRKT
EIISEVNHLDNDKSIEYTVKSHSLFLTQKDKEIIPGNLEDPSEFETPALSTKDSGNLYDS
EIQNVLGVKHGHDMQPACQNDSKIGKKPRLNVCQKSEIIPETNQIYENDNKGVHDLEKDN
FFSLTPKDKETISENLQVTNEFQTVDLLIKDNGNLCDYDTQNILELKKYVTDRKSAEQNE
SKINKLRNKVNWKTEIISEMNQIYEDNDKDAHVQESYTKDLDFKVNKSKQKLECQDIINK
HYMEVNSNEKESCDQILDSYKVVKKRKKESSCKAKNILTKAKNKLASQLTESSQTSISLE
SDLKHITSEADSDPGNPVELCKTQKQSTTTLNKKDLPFVEEIKEGECQVKKVNKMTSKSK
KRKTSIDPSPESHEVMERILDSVQGKSTVSEQADKENNLENEKMVKNKPDFYTKAFRSLS
EIHSPNIQDSSFDSVREGLVPLSVSSGKNVIIKENFALECSPAFQVSDDEHEKMNKMKFK
VNRRTQKSGIGDRPLQDLSNTSFVSNNTAESENKSEDLSSERTSRRRRCTPFYFKEPSLR
DKMRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q562F6	0.999	0.999	0.000	1265	1.000	1.000	Q562F6.pdb.gz	SGO2_HUMAN Shugoshin 2 OS=Homo sapiens OX=9606 GN=SGO2 PE=1 SV=2
2	AFDB:Q7TSY8	0.141	0.150	5.058E-55	1164	0.477	0.518	Q7TSY8.pdb.gz	SGO2_MOUSE Shugoshin 2 OS=Mus musculus OX=10090 GN=Sgo2 PE=1 SV=1
3	AFDB:P86839	0.080	0.080	3.406E-3	1265	0.123	0.123	P86839.pdb.gz	NEST_DANRE Nestin OS=Danio rerio OX=7955 GN=nes PE=2 SV=1
4	AFDB:O42854	0.042	0.035	4.790E-2	1611	0.128	0.101	O42854.pdb.gz	YFHH_SCHPO SH3 domain-containing protein C23A1.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23A1.17 PE=1 SV=1
5	AFDB:Q9VQI9	0.037	0.030	4.790E-2	1673	0.140	0.106	Q9VQI9.pdb.gz	AFFL_DROME AF4/FMR2 family member lilli OS=Drosophila melanogaster OX=7227 GN=lilli PE=1 SV=2
6	AFDB:Q9P219	0.060	0.040	5.165E-2	2028	0.085	0.053	Q9P219.pdb.gz	DAPLE_HUMAN Protein Daple OS=Homo sapiens OX=9606 GN=CCDC88C PE=1 SV=3
7	AFDB:Q8IK49	0.060	0.060	5.571E-2	1263	0.139	0.139	Q8IK49.pdb.gz	Q8IK49_PLAF7 EMP1-trafficking protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1478600 PE=4 SV=1
8	AFDB:Q5VT52	0.046	0.041	7.536E-2	1461	0.117	0.101	Q5VT52.pdb.gz	RPRD2_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPRD2 PE=1 SV=1
9	AFDB:E9PYH6	0.035	0.030	1.186E-1	1716	0.124	0.091	E9PYH6.pdb.gz	SET1A_MOUSE Histone-lysine N-methyltransferase SETD1A OS=Mus musculus OX=10090 GN=Setd1a PE=1 SV=1
10	AFDB:Q9R0I7	0.031	0.029	1.279E-1	1386	0.081	0.074	Q9R0I7.pdb.gz	YLPM1_MOUSE YLP motif-containing protein 1 OS=Mus musculus OX=10090 GN=Ylpm1 PE=2 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q562F6	0.0	2585	1265	1.000	1.000	SGO2_HUMAN Shugoshin 2 OS=Homo sapiens OX=9606 GN=SGO2 PE=1 SV=2
2	Q7TSY8	0.0	697	1164	0.360	0.391	SGO2_MOUSE Shugoshin 2 OS=Mus musculus OX=10090 GN=Sgo2 PE=1 SV=1
3	Q4KLP8	0.003	44.3	663	0.035	0.066	SGO1_XENLA Shugoshin 1 OS=Xenopus laevis OX=8355 GN=sgo1 PE=1 SV=1
4	Q3ZFI7	0.33	37.4	309	0.049	0.201	GAR1_HYPJE D-galacturonate reductase OS=Hypocrea jecorina OX=51453 GN=gar1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09164 VitD-bind_III	3.5e+02	12.6	Vitamin D binding protein, domain III

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350447

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361298	0.974	Kinesin-like protein KIF2C
2	9606.ENSP00000297338	0.973	Double-strand-break repair protein rad21 homolog
3	9606.ENSP00000218089	0.972	Cohesin subunit SA-2
4	9606.ENSP00000377036	0.964	Serine/threonine-protein phosphatase 2A activator
5	9606.ENSP00000477973	0.950	Cohesin subunit SA-3
6	9606.ENSP00000350036	0.949	Structural maintenance of chromosomes protein 1B
7	9606.ENSP00000354720	0.943	Structural maintenance of chromosomes protein 3
8	9606.ENSP00000323421	0.930	Structural maintenance of chromosomes protein 1A
9	9606.ENSP00000372689	0.927	Cohesin subunit SA-1
10	9606.ENSP00000482546	0.897	Meiotic recombination protein REC8 homolog
11	9606.ENSP00000302530	0.888	Mitotic checkpoint serine/threonine-protein kinase BUB1
12	9606.ENSP00000256442	0.886	G2/mitotic-specific cyclin-B1
13	9606.ENSP00000313950	0.881	Aurora kinase B
14	9606.ENSP00000362146	0.854	Borealin
15	9606.ENSP00000263753	0.853	Shugoshin 1
16	9606.ENSP00000386414	0.845	Double-strand-break repair protein rad21-like protein 1
17	9606.ENSP00000428489	0.828	Lymphokine-activated killer T-cell-originated protein kinase
18	9606.ENSP00000287598	0.815	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
19	9606.ENSP00000324804	0.804	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
20	9606.ENSP00000300093	0.791	Serine/threonine-protein kinase PLK1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050789	0.986	regulation of biological process
GO:0022402	0.983	cell cycle process
GO:0016043	0.982	cellular component organization
GO:0050794	0.980	regulation of cellular process
GO:0006996	0.974	organelle organization
GO:0098813	0.956	nuclear chromosome segregation
GO:0010564	0.955	regulation of cell cycle process
GO:0000819	0.953	sister chromatid segregation
GO:0000280	0.952	nuclear division
GO:0048518	0.926	positive regulation of biological process
GO:0048522	0.923	positive regulation of cellular process
GO:0033043	0.809	regulation of organelle organization
GO:0140013	0.769	meiotic nuclear division
GO:0051179	0.741	localization
GO:0033044	0.687	regulation of chromosome organization
GO:0051641	0.611	cellular localization
GO:0045787	0.436	positive regulation of cell cycle
GO:0090068	0.409	positive regulation of cell cycle process
GO:0000278	0.343	mitotic cell cycle
GO:0032501	0.341	multicellular organismal process
GO:0071704	0.322	organic substance metabolic process
GO:0007062	0.322	sister chromatid cohesion
GO:0044238	0.321	primary metabolic process
GO:0044237	0.319	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000775	1.000	chromosome, centromeric region
GO:0032991	0.999	protein-containing complex
GO:0005829	0.999	cytosol
GO:0016604	0.995	nuclear body
GO:0008278	0.985	cohesin complex
GO:0030892	0.704	mitotic cohesin complex
GO:0000793	0.652	condensed chromosome
GO:0005856	0.417	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]