StarFunc result for job id Q567V2

User Input

>input (206 residues)
MARGGWRRLRRLLSAGQLLFQGRALLVTNTLGCGALMAAGDGVRQSWEIRARPGQVFDPR
RSASMFAVGCSMGPFLHYWYLSLDRLFPASGLRGFPNVLKKVLVDQLVASPLLGVWYFLG
LGCLEGQTVGESCQELREKFWEFYKADWCVWPAAQFVNFLFVPPQFRVTYINGLTLGWDT
YLSYLKYRSPVPLTPPGCVALDTRAD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q567V2	1.000	1.000	3.460E-29	206	1.000	1.000	Q567V2.pdb.gz	M17L2_HUMAN Mpv17-like protein 2 OS=Homo sapiens OX=9606 GN=MPV17L2 PE=1 SV=2
2	AFDB:Q8VIK2	0.918	0.945	5.134E-24	200	0.772	0.795	Q8VIK2.pdb.gz	M17L2_MOUSE Mpv17-like protein 2 OS=Mus musculus OX=10090 GN=Mpv17l2 PE=1 SV=1
3	AFDB:P19258	0.740	0.857	2.417E-9	176	0.243	0.284	P19258.pdb.gz	MPV17_MOUSE Protein Mpv17 OS=Mus musculus OX=10090 GN=Mpv17 PE=1 SV=1
4	AFDB:Q06563	0.748	0.779	7.876E-9	197	0.262	0.274	Q06563.pdb.gz	SYM1_YEAST Protein SYM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SYM1 PE=1 SV=1
5	AFDB:Q5TZ51	0.741	0.852	9.076E-9	177	0.252	0.294	Q5TZ51.pdb.gz	MPV17_DANRE Protein Mpv17 OS=Danio rerio OX=7955 GN=mpv17 PE=2 SV=1
6	AFDB:F4K2L8	0.742	0.542	9.975E-9	288	0.252	0.181	F4K2L8.pdb.gz	F4K2L8_ARATH Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein OS=Arabidopsis thaliana OX=3702 GN=At5g19750 PE=1 SV=1
7	AFDB:P42925	0.734	0.776	2.227E-8	194	0.267	0.284	P42925.pdb.gz	PXMP2_MOUSE Peroxisomal membrane protein 2 OS=Mus musculus OX=10090 GN=Pxmp2 PE=1 SV=2
8	AFDB:Q9NR77	0.744	0.781	2.957E-8	195	0.257	0.272	Q9NR77.pdb.gz	PXMP2_HUMAN Peroxisomal membrane protein 2 OS=Homo sapiens OX=9606 GN=PXMP2 PE=1 SV=3
9	AFDB:Q99MS3	0.730	0.772	3.408E-8	194	0.257	0.273	Q99MS3.pdb.gz	MP17L_MOUSE Mpv17-like protein OS=Mus musculus OX=10090 GN=Mpv17l PE=1 SV=2
10	AFDB:O14142	0.734	0.734	6.604E-8	206	0.248	0.248	O14142.pdb.gz	SYM1_SCHPO Protein sym1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sym1 PE=3 SV=1
11	PDB:4jrzA	0.142	0.182	3.189E-1	155	0.117	0.155	4jrzA.pdb.gz	Crystal Structures of Leukotriene C4 Synthase in Complex with Product Analogs: IMPLICATIONS FOR THE ENZYME MECHANISM.
12	PDB:1fx8A	0.211	0.179	8.205E-1	254	0.131	0.106	1fx8A.pdb.gz	Structure of a glycerol-conducting channel and the basis for its selectivity.
13	PDB:6swy8	0.146	0.104	8.602E-1	325	0.126	0.080	6swy8.pdb.gz
14	PDB:4ntaA	0.147	0.195	1.089	147	0.131	0.184	4ntaA.pdb.gz
15	PDB:6jmqA	0.176	0.102	1.089	403	0.131	0.067	6jmqA.pdb.gz	Cryo-EM structure of the human L-type amino acid transporter 1 in complex with glycoprotein CD98hc.
16	PDB:3emlA	0.216	0.137	1.255	448	0.131	0.060	3emlA.pdb.gz	The 2.6 Angstrom Crystal Structure of a Human A2A Adenosine Receptor Bound to an Antagonist.
17	PDB:7lciR	0.125	0.093	1.316	393	0.107	0.056	7lciR.pdb.gz	Evolving cryo-EM structural approaches for GPCR drug discovery.
18	PDB:5b35A	0.272	0.254	1.380	225	0.160	0.147	5b35A.pdb.gz	Membrane protein structure determination by SAD, SIR, or SIRAS phasing in serial femtosecond crystallography using an iododetergent
19	PDB:7cmhB	0.167	0.094	1.667	458	0.112	0.050	7cmhB.pdb.gz	Structural insight into the substrate recognition and transport mechanism of the human LAT2-4F2hc complex.
20	PDB:6hcyC	0.187	0.114	1.747	436	0.102	0.048	6hcyC.pdb.gz	Cryo-EM structures of human STEAP4 reveal mechanism of iron(III) reduction.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q567V2	1.25e-150	417	206	1.000	1.000	M17L2_HUMAN Mpv17-like protein 2 OS=Homo sapiens OX=9606 GN=MPV17L2 PE=1 SV=2
2	Q8VIK2	7.71e-115	327	200	0.772	0.795	M17L2_MOUSE Mpv17-like protein 2 OS=Mus musculus OX=10090 GN=Mpv17l2 PE=1 SV=1
3	Q06563	1.09e-17	79.3	197	0.262	0.274	SYM1_YEAST Protein SYM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SYM1 PE=1 SV=1
4	Q5TZ51	1.25e-16	76.3	177	0.248	0.288	MPV17_DANRE Protein Mpv17 OS=Danio rerio OX=7955 GN=mpv17 PE=2 SV=1
5	P19258	2.79e-16	75.1	176	0.248	0.290	MPV17_MOUSE Protein Mpv17 OS=Mus musculus OX=10090 GN=Mpv17 PE=1 SV=1
6	Q99MS3	7.10e-16	74.7	194	0.243	0.258	MP17L_MOUSE Mpv17-like protein OS=Mus musculus OX=10090 GN=Mpv17l PE=1 SV=2
7	P39210	7.54e-16	73.9	176	0.252	0.295	MPV17_HUMAN Protein Mpv17 OS=Homo sapiens OX=9606 GN=MPV17 PE=1 SV=1
8	Q10244	9.93e-16	74.7	221	0.199	0.186	YD1E_SCHPO Uncharacterized protein C4G9.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4G9.14 PE=3 SV=1
9	P42925	4.41e-15	72.4	194	0.233	0.247	PXMP2_MOUSE Peroxisomal membrane protein 2 OS=Mus musculus OX=10090 GN=Pxmp2 PE=1 SV=2
10	Q07066	6.47e-15	72.0	194	0.257	0.273	PXMP2_RAT Peroxisomal membrane protein 2 OS=Rattus norvegicus OX=10116 GN=Pxmp2 PE=1 SV=2
11	F4K2L8	1.02e-14	73.2	288	0.257	0.184	F4K2L8_ARATH Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein OS=Arabidopsis thaliana OX=3702 GN=At5g19750 PE=1 SV=1
12	Q2QL34	1.38e-14	71.2	196	0.228	0.240	MP17L_HUMAN Mpv17-like protein OS=Homo sapiens OX=9606 GN=MPV17L PE=1 SV=1
13	O14142	2.44e-13	68.2	206	0.233	0.233	SYM1_SCHPO Protein sym1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sym1 PE=3 SV=1
14	Q9VN75	7.88e-13	66.2	193	0.184	0.197	Q9VN75_DROME IP08061p OS=Drosophila melanogaster OX=7227 GN=plh PE=2 SV=2
15	Q9NR77	1.29e-09	57.8	195	0.282	0.297	PXMP2_HUMAN Peroxisomal membrane protein 2 OS=Homo sapiens OX=9606 GN=PXMP2 PE=1 SV=3
16	Q9LV46	1.88e-09	57.8	235	0.194	0.170	Q9LV46_ARATH Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein OS=Arabidopsis thaliana OX=3702 GN=At3g24570 PE=1 SV=1
17	Q9W0B2	3.23e-07	50.8	191	0.136	0.147	Q9W0B2_DROME LD19311p OS=Drosophila melanogaster OX=7227 GN=anon-WO0118547.268 PE=1 SV=1
18	A0A0S0WGR0	8.06e-07	50.4	255	0.146	0.118	A0A0S0WGR0_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=anon-WO0118547.268 PE=1 SV=1
19	Q08743	2.35e-05	46.2	309	0.136	0.091	YO292_YEAST Vacuolar membrane protein YOR292C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YOR292C PE=1 SV=1
20	U9W802	0.037	36.6	307	0.170	0.114	WSC_NEUCR Woronin sorting complex protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=wsc PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04117 Mpv17_PMP22	4.2e-28	108.6	Mpv17 / PMP22 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000469836

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369383	0.832	Protein Mpv17
2	9606.ENSP00000379669	0.826	Mpv17-like protein
3	9606.ENSP00000287025	0.734	Transcription termination factor 3, mitochondrial
4	9606.ENSP00000481559	0.728	rRNA methyltransferase 1, mitochondrial
5	9606.ENSP00000332340	0.687	Probable ATP-dependent RNA helicase DDX28
6	9606.ENSP00000355566	0.687	Mitochondrial import receptor subunit TOM20 homolog
7	9606.ENSP00000309561	0.686	MICOS complex subunit MIC13
8	9606.ENSP00000236980	0.652	FAST kinase domain-containing protein 2, mitochondrial
9	9606.ENSP00000264230	0.643	Nitric oxide-associated protein 1
10	9606.ENSP00000419370	0.631	Mitochondrial assembly of ribosomal large subunit protein 1
11	9606.ENSP00000306080	0.595	rRNA methyltransferase 3, mitochondrial
12	9606.ENSP00000323047	0.567	Mitochondrial ribosome-associated GTPase 1
13	9606.ENSP00000419740	0.564	5-methylcytosine rRNA methyltransferase NSUN4
14	9606.ENSP00000254928	0.562	GTPase Era, mitochondrial
15	9606.ENSP00000384886	0.555	Gamma-interferon-inducible lysosomal thiol reductase
16	9606.ENSP00000254799	0.530	G-rich sequence factor 1
17	9606.ENSP00000259632	0.518	Dynactin subunit 3
18	9606.ENSP00000347767	0.512	Serine/threonine-protein kinase Nek5
19	9606.ENSP00000259873	0.504	Mitochondrial ribosomal protein S18B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.992	biological regulation
GO:0071840	0.991	cellular component organization or biogenesis
GO:0050789	0.982	regulation of biological process
GO:0050794	0.971	regulation of cellular process
GO:0016043	0.962	cellular component organization
GO:0006996	0.949	organelle organization
GO:0031326	0.945	regulation of cellular biosynthetic process
GO:0060255	0.924	regulation of macromolecule metabolic process
GO:0051171	0.921	regulation of nitrogen compound metabolic process
GO:0080090	0.920	regulation of primary metabolic process
GO:0062125	0.910	regulation of mitochondrial gene expression
GO:0006417	0.873	regulation of translation
GO:0070129	0.861	regulation of mitochondrial translation
GO:0048518	0.843	positive regulation of biological process
GO:0048522	0.830	positive regulation of cellular process
GO:0042254	0.818	ribosome biogenesis
GO:0010604	0.764	positive regulation of macromolecule metabolic process
GO:0034250	0.726	positive regulation of amide metabolic process
GO:0045727	0.696	positive regulation of translation
GO:0042255	0.403	ribosome assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.983	intracellular organelle lumen
GO:0016020	0.946	membrane
GO:0043232	0.885	intracellular non-membrane-bounded organelle
GO:0032991	0.869	protein-containing complex
GO:0031090	0.862	organelle membrane
GO:0005759	0.837	mitochondrial matrix
GO:0005743	0.792	mitochondrial inner membrane
GO:0098798	0.729	mitochondrial protein-containing complex
GO:0005840	0.585	ribosome
GO:0000313	0.568	organellar ribosome
GO:0005761	0.563	mitochondrial ribosome
GO:1990904	0.534	ribonucleoprotein complex
GO:0031981	0.452	nuclear lumen
GO:0005654	0.386	nucleoplasm
GO:0015934	0.375	large ribosomal subunit
GO:0005762	0.361	mitochondrial large ribosomal subunit

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]